KEGG   Vibrio vulnificus YJ016: VV3004Help
Entry
VV3004            CDS       T00150                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00620  Pyruvate metabolism
vvy00680  Methane metabolism
vvy01100  Metabolic pathways
vvy01120  Microbial metabolism in diverse environments
vvy01200  Carbon metabolism
Module
vvy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV3004
  09102 Energy metabolism
   00680 Methane metabolism
    VV3004
Enzymes [BR:vvy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VV3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAC95768
UniProt: Q7MH68
LinkDB All DBs
Position
I:3081345..3084011
Genome map
AA seq 888 aa AA seqDB search
MDVIFLRGRMTMNEKYAALKSNVSMLGHLLGNTIQEAHGDEILEKVETIRKLSKSARAGN
QADRNNLIEEIKSLPDEQLTPVARAFNQFLNLTNIAEQYHTISRHCDAHVCEPDAINTLF
AKLGQNGINKLDTAQAIRELNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYK
ERHKTEKRLEQLIAQSWHSDVIRKQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDEKLK
DYLDQGLPIDARPVHFSSWMGGDRDGNPFVTHTVTREVLLLSRWKAADLYLKDINELISE
LSMTKCNDTVRQLAGEDEHEPYRAILKQLRTLLSDTKEILDAKINGQKLAVKAPLQSVEQ
LWDPLFACYQSLRECGMSMIAEGSLLDTLRRVKAFGVHLVRLDIRQESTRHADVLSELTR
YLGIGDYNHWSEQDKIAFLTNELASKRPLLPRDWQPSEPVKEVLDTCKIIAAQSREAFGA
YVISMAKTASDVLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEAVIKQLMSIDLYRGFI
QNHQMVMIGYSDSAKDAGVMAAGWAQYHAMEALVNVAEQEGIELTLFHGRGGTIGRGGAP
AHAALLSQPPKSLKGGLRVTEQGEMIRFKLGLPDVAVNSFNMYASAILEANLLPPPEPKQ
EWRDLMEVLSQVSCEAYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVES
LRAIPWIFSWSQNRLLLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVY
LKCNSEISRYYDERLADKSLLPLGDRLRDQLQSDIKAVLNVENNENLMQSDPWGQESIRL
RNIYIEPLNMLQAELLYRTRQAGVVSEELEEALMVTIAGIAAGMRNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaatttttttacgaggcaggatgacaatgaacgagaaatacgccgcgctcaag
agtaatgtcagcatgttggggcacttattgggtaacaccattcaagaagcccatggcgac
gaaatcttagagaaggtggagaccattcgtaagctctccaaatctgcccgcgcaggcaat
caggctgatcgtaacaacctgattgaagaaatcaaaagcctgccagatgagcaactcacc
ccggtggctcgcgcttttaaccaatttctgaatttgaccaacattgccgagcaataccac
accatctctcgccattgcgatgcacacgtgtgtgagccggatgcgatcaatacgctgttt
gctaagcttggtcaaaacggcatcaataaactcgataccgcccaagcgattcgtgaattg
aacattgaactggtgctgactgcgcacccgacggaaatcacgcgccgcaccatgatcaat
aaactggtcaaaatcaacgaatgcctgtctaaattagagctgagcgatctttcttacaaa
gagcgccacaagacagaaaaacgcctcgagcaacttatcgcccagagctggcactcagac
gtgattcgcaaacagcgcccaacaccactcgatgaagcgaagtgggggtttgccgtagtg
gaaaattcactctgggaagcagtgccagactttctacgcgaactcgatgaaaagctcaaa
gactatctagaccaaggcttgccaattgatgctcgccctgttcacttctcatcttggatg
ggtggtgaccgagatggcaacccgtttgtgacccatactgtgacacgagaagtgttgcta
ctctcgcgctggaaagcggcggatctttacctcaaagacatcaatgagttgatcagcgag
ctgtcaatgaccaagtgcaacgacaccgttcgtcaattggcaggtgaagatgaacacgag
ccttatcgtgccatcctgaaacaactgcgcacgctgctgagtgataccaaagagatcctg
gatgcgaaaattaacggccagaagctggcagtaaaagcgccgctgcaaagtgttgagcaa
ctttgggatcctcttttcgcttgttatcagtcattacgcgaatgtggcatgagcatgatc
gccgaaggctcactactcgatacactacgtcgtgtcaaagcgtttggtgtgcatctggtt
cgcttggacattcgccaagaaagtactcgtcacgctgatgtcctttctgaactgacgcgt
tacttaggcattggtgattacaatcactggagcgaacaagacaaaattgcgttcttgacc
aatgagttggcatcgaagcgcccattgctaccgcgtgattggcaaccttcagagccagtg
aaagaagtgctcgatacgtgcaaaatcattgccgcgcaatctcgtgaagcgtttggtgct
tacgtcatctcgatggccaagactgcctctgatgtactcgcggtgcatctactgctgcaa
gaatcaggctgtccttatcgcatggatgtttgcccgctgtttgaaacgctcgacgatcta
aacaacgccgaagcggtgatcaaacaattgatgagcattgacctctatcgtggctttatt
caaaaccatcaaatggtgatgatcggttattccgactcagcaaaagacgcgggcgtaatg
gcggcgggttgggcccaataccacgcaatggaagccttagtgaacgttgctgaacaagaa
ggcattgagctgaccttattccacggccgtggcggtaccattggtcgtggcggtgcaccc
gctcatgcagcgctgctctctcaaccaccaaagagcttgaaaggcggcctacgcgtcacc
gaacaaggtgagatgattcgcttcaaactcggtttgcctgatgtggctgttaacagcttc
aacatgtacgccagtgcgatccttgaagctaatttgctaccaccaccagagccaaaacaa
gagtggcgcgatctgatggaagtgctgtcgcaagtaagctgtgaagcctaccgaagtgtg
gttcgtggtgagccagactttgtcccttacttccgccaagcaacacctgagctggaattg
ggtaaactgcctctaggctctcgccctgccaagcgtaacccaaatggtggcgtggaaagc
ctacgtgcgattccttggattttctcttggagccaaaaccgcttgctattgcctgcgtgg
ttaggtgctggtgaagcgattcagtactcgattgacaaaggccatcaagcgcttttggaa
gaaatgtgccgtgaatggccatttttctccacgcgtttgggcatgcttgagatggtgtac
ctcaagtgtaacagtgagatttctcgttactatgatgaacgtctcgccgacaaatcactg
ctacctctgggtgatcgtttacgtgatcagctgcaaagcgacatcaaagccgtgcttaac
gtcgaaaacaacgagaacttgatgcaaagcgatccttggggtcaagagtctattcgacta
cgtaatatctacatcgaaccgttgaatatgcttcaagcagaactgctttaccgcactcgc
caagctggcgtggtatcggaagagcttgaagaagcgttgatggtgaccatcgcgggtatc
gccgcaggtatgcgtaacaccggttaa

DBGET integrated database retrieval system