KEGG   Vibrio vulnificus YJ016: VVA0291Help
Entry
VVA0291           CDS       T00150                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Brite
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VVA0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu RnlA_toxin
Motif
Other DBs
NCBI-ProteinID: BAC96317
UniProt: Q7MFM9
LinkDB All DBs
Position
II:complement(332061..332573)
Genome map
AA seq 170 aa AA seqDB search
MNKHTLLAAILLYSTSSFAQSLSVDMKDLSSNQTLGTVTISSSDYGTVFTPDLKGLPSGL
HGFHLHANGSCESSNKDGKVVLGGAAGGHYDPQNSGKHGYPWTEDNHLGDLPALFVDASG
NASQPVLAPRVALKDVQGRALMIHAGADNHSDHPMPLGGGGARIVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacacaccttacttgctgccattttgctttattcgacctcttcatttgcgcag
agtttgagcgttgacatgaaggacctatccagcaatcaaacactcggcaccgtgaccatc
agttcaagtgactacggaacggtgtttactcctgatcttaaggggctacctagtggcctg
cacggttttcatctccacgccaatggaagctgtgagagcagcaacaaagacggcaaagtg
gtattaggaggggcggctggtggacactatgatccgcaaaatagtggcaaacacggctat
ccatggacagaagacaatcaccttggcgatctaccagcactgtttgttgatgcatcaggt
aatgcgtcacagccagtgcttgcccctcgtgttgcgttaaaagatgtccaaggccgcgct
ctgatgatccatgctggggctgacaatcactctgatcacccaatgcctctgggtggcggc
ggtgccagaattgtgtgtggtgtgatcaaataa

DBGET integrated database retrieval system