KEGG   Vibrio vulnificus YJ016: VVA0500Help
Entry
VVA0500           CDS       T00150                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00550  Peptidoglycan biosynthesis
vvy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VVA0500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vvy01002]
    VVA0500
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
    VVA0500
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VVA0500
Peptidases [BR:vvy01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VVA0500
Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VVA0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAC96526
UniProt: Q7MF20
LinkDB All DBs
Position
II:567621..568796
Genome map
AA seq 391 aa AA seqDB search
MAAFMKSIVSLTSALCASVMAFSAHAAPTVIPDPPALGAKGYVLMDYHSGEVLVAKNADT
QLNPASLTKLMTAYVAGQEMNRGNIRFSDQVVISRNAWAKNFPDSSKMFIEVGTSVSLED
LYRGLIIQSGNDASVAIAEHVAGSQDAFVSLMNSWADKLGLQNSAFTNPHGLDSTGLYST
PRDIAKLGQAIIRDLPSVYPMYSETSFTYNGITQYNRNGLLRDRSIAVDGMKTGFTSGAG
YSLATSATSGNMRLISVVMGSNSTSSREAESKQLLSYGFRFFDTVSPTKANQPLADTRIW
MGEKNQLSVGLKEDIFLTLPKGDTKKLQAELIYLPDLSAPILRDQVVGQVVYKVEDKVVK
EVDLVALESVEQGGLFKRITDWFKRWLSNLF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttcatgaaatctattgtttctcttacttccgctttgtgtgccagcgttatg
gcattttccgctcacgccgcgccgaccgtcattcccgatcctcccgctttgggtgccaaa
ggctatgtgctgatggactaccattcaggggaagtattggtcgccaaaaatgccgatact
cagctaaatcctgccagtttaaccaaattgatgacggcgtatgtggcggggcaagaaatg
aatcgcggcaacattcgcttttcagatcaggtggtgatcagccgtaacgcatgggcaaaa
aacttcccagattcttcgaaaatgtttatcgaagtcggtacttctgtgagcttggaagat
ctctaccgaggtctgatcatccagtcgggtaatgacgcgagtgtcgccatcgccgagcat
gtggcaggtagccaagatgcgtttgtcagtttgatgaactcgtgggccgacaagcttggt
ttacaaaactccgccttcaccaaccctcatggcttggacagcaccggtctctattcaaca
ccacgtgacattgccaagttggggcaggcgatcattcgtgatttgcctagtgtttacccg
atgtacagtgaaacctcgtttacttacaacggcattacgcaatacaaccgcaatggattg
ctgcgagaccgaagtattgccgtggatggcatgaaaacaggcttcactagtggcgctggt
tacagtttggcgacgtctgccaccagtggcaacatgcgcttaatttcggtggtgatgggg
tccaacagtacttcaagccgtgaagcggagagcaaacaactgctgagctacggtttccgc
ttctttgatacggtttccccaacgaaagcgaatcagccgctggcagacactcgaatttgg
atgggagagaagaatcagttaagcgttggtcttaaagaggacattttccttaccttgccc
aaaggggataccaaaaagcttcaagctgagctgatttatctgccggacttatcagcgcca
atcttgcgtgatcaggtggttggtcaggtggtttataaagttgaagataaggtggtaaaa
gaggtcgatcttgtggcgttagaatccgttgagcaaggtgggctgtttaaacgcattacc
gattggtttaagcgttggttgagcaatctgttttaa

DBGET integrated database retrieval system