KEGG   Vibrio vulnificus YJ016: VVA0785Help
Entry
VVA0785           CDS       T00150                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00473  D-Alanine metabolism
vvy00550  Peptidoglycan biosynthesis
vvy01100  Metabolic pathways
vvy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VVA0785
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VVA0785
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VVA0785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
    VVA0785
Enzymes [BR:vvy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VVA0785
Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
 Precursor biosynthesis
  Amino acid ligase
   VVA0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 TTL
Motif
Other DBs
NCBI-ProteinID: BAC96811
UniProt: Q7ME85
LinkDB All DBs
Position
II:887502..888497
Genome map
AA seq 331 aa AA seqDB search
MMRNVLLLCGGGSSEHEISLLSSEYLQQQLGLIENVNVLKVEIKNEGWFDQKERLVYLDI
HTKSVKSDEFNESIDIDFIVPCIHGFPGETGDIQSLFELAGIPYLGCGPEASSNSFNKIT
SKLWYDAIGIPNTPYLFLTENNEESHQLSREAFDKWGKLFVKAARQGSSVGCYSVTNIEQ
LSDAIDKAFGFSHQVLVEKAVKPRELEVSAYEMNGQLHISKPGEIIAPDGAFYSYDEKYS
AGSHSITEVEAKNLTEQQLATIQLCSEKVFRQMNLRHLSRIDFFLTSEGEIYLNEVNTFP
GMTKISMFPKMLQHNGHKFHEFLADCIERSL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatgttctacttttatgcggcggtggttcttcagaacacgaaatttcgctg
ctttcttctgaataccttcagcaacaacttggcttaattgagaatgtaaatgtcctaaaa
gttgagattaagaacgaaggttggtttgaccaaaaagagagacttgtgtatctcgatatc
catacgaaaagcgtgaaaagcgatgagtttaatgaatcgatagacatcgatttcattgta
ccttgtattcatggctttccgggtgaaacaggggatattcaatcactttttgagcttgca
ggtattccttatctgggttgtgggcctgaagctagcagtaacagcttcaataaaatcacg
tcgaaactatggtatgacgcgattggcattcctaacacaccgtatcttttcctaacagag
aacaacgaagagtctcaccagctcagtagagaggcattcgataaatggggcaaactgttt
gtcaaagcggcgagacaggggtcatcggttggttgttacagtgtaactaacatagagcag
ctttctgatgccattgataaagcgttcggattctctcatcaggtattggttgaaaaggca
gtaaaaccaagagaattagaagtttccgcatatgagatgaacggtcaacttcatatttca
aagccaggtgaaattattgctccagacggcgctttttactcctacgatgagaaatacagt
gcgggtagccattcaatcacagaagtagaagcgaaaaacttaaccgaacagcagctagcg
acgattcaactgtgcagcgagaaagtctttcgtcaaatgaaccttcgtcatttgtctcga
atcgatttcttcttaaccagcgaaggtgagatctaccttaatgaagtgaatacctttcct
ggaatgacaaaaatttccatgttccccaaaatgctccaacacaatggacataagtttcat
gaattcctagcggactgcattgaacgctcactttaa

DBGET integrated database retrieval system