KEGG   Vibrio vulnificus YJ016: VVA1029Help
Entry
VVA1029           CDS       T00150                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00473  D-Alanine metabolism
vvy01100  Metabolic pathways
vvy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VVA1029
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VVA1029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
    VVA1029
Enzymes [BR:vvy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VVA1029
Peptidoglycan biosynthesis and degradation proteins [BR:vvy01011]
 Precursor biosynthesis
  Racemase
   VVA1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAC97055
UniProt: Q7MDK7
LinkDB All DBs
Position
II:1141560..1142786
Genome map
AA seq 408 aa AA seqDB search
MNFKKTLLSIAIASASLTPAFSYSAPLLLDNTVHQTSQIAGSNAWLEISLGQFKSNIEQF
KSHIAPQTKICAVMKADAYGNGIRGLMPTILEQQIPCVAIASNAEAKLVRESGFEGELIR
VRSASTSEIEQALSLDIEELIGSEQQARELASLAEKYSKTIKVHLALNDGGMGRNGIDMS
TERGQKEAVAIATHPSVAVVGIMTHFPNYNAEDVRTKLKSFNQHAQWLMESAGLKREEIT
LHVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVAFKTRVASLHSLPAGSTVGY
DSTFTTANDAVMANLTVGYSDGYPRKMGNKAQVLINGQRANVVGVASMNTTMVDVSNIKG
VLPGDEVTLFGAQKNQHISVGEMEENAEVIFPELYTIWGTSNPRFYVK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaaaaagacccttctatccattgccatcgctagcgccagtctcactccggct
ttctcttacagcgcacctctcttactcgacaacacggttcaccaaaccagccaaatcgcc
gggtccaatgcttggctcgaaatcagcctcggccaattcaaaagcaacattgaacaattt
aaatcgcacattgccccacaaaccaaaatttgtgcggtgatgaaagccgacgcttatggc
aacggaattcgtggcttgatgccaaccattcttgaacaacaaattccctgcgtggctatc
gccagtaatgcggaggctaaactcgtccgagaaagtgggtttgaaggcgagttaattcgc
gtgcgctccgctagcacaagtgaaattgaacaggcactctctcttgatatcgaagagtta
attggcagtgagcaacaagctcgtgagttagcaagcttggcagaaaagtacagcaaaacc
attaaagttcaccttgctcttaatgacggtggcatgggccgtaatggtattgatatgagt
accgaacgtggacaaaaagaagcagtcgccattgcaacgcacccttcggttgcagtggtc
ggtatcatgacccatttcccgaattacaatgcagaggatgtacgaacaaagctaaaaagc
tttaaccaacatgcacagtggttaatggaaagtgcagggctaaaacgtgaagagatcacc
ctacatgtggccaattcctacaccgcgttgaatgtccctgaagcgcagttggatatggtt
cgcccaggtggtgtgctctatggtgatctcccgaccaaccctgagtacccttctattgtg
gcgttcaaaacccgcgtagcttcacttcattcgcttccggcaggcagcaccgtgggttac
gacagcacgtttaccacagcaaatgacgcggtgatggcaaacctcacagtcggctattcc
gatggctacccacgaaaaatgggcaacaaagcgcaagtgctgatcaacggccagcgcgcc
aatgtggtgggcgttgcttcaatgaatactacgatggtggatgtgtccaatatcaaaggc
gtgttacccggcgacgaggtgacgctctttggtgctcaaaagaaccagcacatctctgtc
ggtgaaatggaagaaaacgccgaggtaattttcccagagctttacaccatttggggcacc
agcaacccacgtttctatgtgaaatga

DBGET integrated database retrieval system