KEGG   Candidatus Woesebacteria bacterium GW2011_GWF1_31_35: UR17_C0001G0815Help
Entry
UR17_C0001G0815   CDS       T04464                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit C, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
wba  Candidatus Woesebacteria bacterium GW2011_GWF1_31_35
Pathway
wba00970  Aminoacyl-tRNA biosynthesis
wba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UR17_C0001G0815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wba03029]
    UR17_C0001G0815
Enzymes [BR:wba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     UR17_C0001G0815
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     UR17_C0001G0815
Mitochondrial biogenesis [BR:wba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UR17_C0001G0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AKM83583
LinkDB All DBs
Position
complement(694446..694754)
Genome map
AA seq 102 aa AA seqDB search
MTRLTKKEVLHVAELSNLKLSEGEVKKFLPQLSKIIEYVSQLSKVNTKEIKPTSQTTGLT
NVYRENSNELGETLTQEEVLSNTDGYNGFFKVPAILEGRTNK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgacacggttaacaaaaaaagaagtacttcatgttgcagagttatcaaatttaaaatta
tcagaaggtgaagtaaagaaatttttaccacagctttcaaaaattatcgaatatgtaagt
caactatccaaagtcaatacaaaagaaattaaacctacaagtcaaactacaggacttaca
aatgtttatagagaaaattcgaatgaattgggagaaactttaactcaagaagaagttctt
tcaaatactgatggatataatggtttttttaaagtgccagcaattttagaaggtagaact
aataaatga

DBGET integrated database retrieval system