KEGG   Wolbachia wBm (Brugia malayi): Wbm0435Help
Entry
Wbm0435           CDS       T00234                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00480  Glutathione metabolism
wbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Wbm0435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:wbm02000]
    Wbm0435
Enzymes [BR:wbm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Wbm0435
Transporters [BR:wbm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Wbm0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C Tom37 Glutaredoxin GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AAW71023
UniProt: Q5GSK1
LinkDB All DBs
Position
565886..566539
Genome map
AA seq 217 aa AA seqDB search
MILYHFPLCPFSRKVRALLKEKKLSCNLVHENPWEKRNEFMKINPTGQVPVLIDNNFIIT
DSNAICEYLEETYNSDIKLLDSSTVIKSQIRALINWFDNKFYNEVTKYIINEKVIINRSP
DSRFLHAAQHNLSCHIEYIEYLINKNVCLVTDKFTLADITLASHISVMDYVNSFPWEKSK
ILKEWYSIVKSRPCFREMLLERVPGLTPPLHYANFDF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatcattttcctctttgtccgttctcacgaaaagttagagcccttcttaag
gaaaaaaagctgagctgcaatttagtacatgaaaacccgtgggaaaagcggaatgaattt
atgaagattaatccaactggacaggtaccagtgcttatagataacaactttattataaca
gacagcaacgctatttgtgaatatctagaagaaacttataatagcgatatcaaattgctt
gactcgtctactgttattaaatctcaaatacgtgctttaattaattggtttgataataaa
ttttataatgaagttactaaatatattataaatgagaaagtaataattaaccgcagtcct
gactctagatttctccatgcagctcaacataatctatcttgccatatagagtacattgag
tacttaattaacaaaaacgtttgtctcgtaactgataagttcactttagctgacattact
ttagcatcacatatttctgtaatggattatgtaaatagttttccatgggaaaaaagtaaa
attctaaaagaatggtattccattgttaagtcaaggccttgttttcgtgagatgttatta
gaaagagttcctgggttaactcctcctctgcactatgccaactttgatttttag

DBGET integrated database retrieval system