KEGG   Wolbachia wBm (Brugia malayi): Wbm0448Help
Entry
Wbm0448           CDS       T00234                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit, SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00020  Citrate cycle (TCA cycle)
wbm00190  Oxidative phosphorylation
wbm00650  Butanoate metabolism
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01120  Microbial metabolism in diverse environments
wbm01130  Biosynthesis of antibiotics
wbm01200  Carbon metabolism
Module
wbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wbm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Wbm0448
   00650 Butanoate metabolism
    Wbm0448
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Wbm0448
Enzymes [BR:wbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Wbm0448
    1.3.5.4  fumarate reductase (quinol)
     Wbm0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAW71036
UniProt: Q5GSI8
LinkDB All DBs
Position
complement(584834..586639)
Genome map
AA seq 601 aa AA seqDB search
MNKSAYEIVEHEYDVVVVGAGGAGLRATLGMAATNFSVACISKIFPTRSHTVAAQGGISA
ALGNIAEDDWRWHAYDTIKGSDWLGDQDAIEYMCKNAAKAVIELENFGVPFSRTGNGKIY
QRPFGGMTTHFGKGKSAQRTCAAADKTGHAILHTLYQQCLKFNTEFFVEYFVIDLIIDNE
TGACCGVLAWSLCEGTLHKFRAHSVVLATGGYGRVYFSATSAHTCTGDGNGMVVRAGLPL
EDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLVNSQGERFMERYAPKVKDLASRDVVSRAI
TIEIREGRGVGPKKDHIYLTIAHLDPEIIKLRLPGISETARTFAGVDVTKDPIPVIPTVH
YNMGGIPTNYHGEVVTLKESKEEVVEGLFAIGEAACISVHGANRLGSNSLLDLVVFGRAA
ALRAKKKLKPNMPHKKLNSACIDWIVDRFNKMRFASGGLRVSKIRSEMQHTMQKYASVFR
VAEVLEEGKRAIKGVAKMMPDIAIEDRSMVWNSDLVEALELANMIPQAVITMECAANREE
SRGAHAREDFPERDDKNWMKHTIAWLEEKEGQINTRIDYKKVAENTLSDEIDFIAPEKRV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcagcgtatgaaatcgtagaacatgaatatgatgtagtggtggtaggtgca
ggtggggcagggctcagggcaacacttggaatggctgctactaacttctcggttgcttgc
atttctaaaatttttcctacacgcagtcatacagttgcagcacaaggtggaattagtgcg
gctctaggtaatattgctgaagatgattggcgctggcatgcgtatgacacaataaaaggc
tcagactggcttggtgatcaagacgcaatagaatatatgtgtaaaaacgctgctaaagct
gttattgaacttgaaaatttcggtgtacctttttctcgtacagggaatggtaaaatatac
cagcgtccctttggtggaatgacaactcattttggcaaaggaaaatcagcccagcgtact
tgtgcagcagcagacaaaactgggcatgcgatccttcacactctatatcagcagtgtctt
aaatttaacactgaattttttgtcgaatattttgtaatcgatttaatcatagataacgaa
accggggcgtgctgtggagttctcgcttggtcgctatgcgagggtacattacataaattt
cgtgcacattcggtggtattagcaacaggtggatatggacgtgtttatttctctgcaaca
agcgcacacacctgcacaggtgatggtaatggaatggtggtaagagctggattaccactt
gaagatatggagtttgtgcaatttcatccaacaggaatatatggttcagggtgcttaatg
acagaaggatgtcgtggtgaaggcgggtaccttgttaattctcagggcgaaaggtttatg
gagcgttatgcgccaaaggtaaaagatttagcttctcgtgatgtagtaagtcgtgcaata
acaattgaaattagagagggaagaggtgtaggaccgaaaaaagaccacatatatttaact
atagcgcatcttgatccggaaataataaaactgagacttccaggaattagcgaaactgca
aggacctttgcaggggttgatgttactaaagatccaatacctgttattccaactgtgcat
tacaatatgggcggtattccaactaattatcatggagaagtggttacactgaaggaaagt
aaagaagaagtggtagaaggattatttgcaatcggagaagcagcgtgtatatctgtacat
ggtgcaaatcggcttggttctaactcacttcttgatcttgtagtttttggtagagctgca
gcactcagagcaaaaaagaaactaaagcctaatatgccacacaaaaaattaaactcagct
tgtatagattggatagtagatagattcaataaaatgcggtttgcttccggagggctcaga
gtatcaaaaatacgcagcgagatgcagcacactatgcaaaaatatgcatcagtgttccgt
gttgctgaggttttagaagaaggtaaaagagctataaaaggagtagcaaaaatgatgcct
gatattgcaattgaagaccgcagcatggtatggaacagcgacttagttgaagcgttggag
cttgctaacatgattccacaagcggttattactatggagtgtgcagccaatcgcgaggaa
agcagaggtgctcatgctcgtgaagattttcctgaacgtgatgacaagaactggatgaag
cacactatagcgtggctcgaggaaaaggaagggcaaatcaatacgagaattgattacaag
aaagttgctgaaaacactctgagtgatgagattgatttcatcgcgccagagaagagggtt
tattga

DBGET integrated database retrieval system