KEGG   Wolbachia wBm (Brugia malayi): Wbm0470Help
Entry
Wbm0470           CDS       T00234                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00061  Fatty acid biosynthesis
wbm00780  Biotin metabolism
wbm01100  Metabolic pathways
wbm01130  Biosynthesis of antibiotics
wbm01212  Fatty acid metabolism
Module
wbm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Wbm0470
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Wbm0470
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Wbm0470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:wbm01004]
    Wbm0470
Enzymes [BR:wbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Wbm0470
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Wbm0470
Lipid biosynthesis proteins [BR:wbm01004]
 Fatty acid synthase
  Component type
   Wbm0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AAW71058
UniProt: Q5GSG6
LinkDB All DBs
Position
613360..614172
Genome map
AA seq 270 aa AA seqDB search
MAISLLQGKKGLITGIINKRSIAYGIVKTLSEHGAESAVTYQNEIVKERLLSIAAELNVE
LVLNCDVANEGTIDDVFKSIEEKWGTLDFLVHAIAFSDKNELSGKYVNTSLNNFQNAMNI
SCYSFTALAQRAEKMMPNGGSLLTLSYYGAEKVMPNYNVMGLCKAALEASVKYLACDLGP
QNIRVNAISAGPIRTLASSGISDFHFISEWNRNNSPLRRNTTLEDVGKAALYLLSDLSSG
TTGEILHVDSGYNVVGMKAIDSNIINSYQN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcaataagtctactacaaggcaaaaagggattaataactggaataataaacaagaga
tcgatagcgtacggtatagtaaaaactctctcagagcatggtgcagaatctgcagtcact
taccagaatgaaatagtaaaagagagattattatcaatagcagctgaattaaatgtggag
ctagtattaaactgtgatgttgcaaatgaaggaactatagatgatgttttcaagtcaata
gaagaaaaatggggtacccttgattttttggtacatgcaattgcattctctgacaaaaac
gaattaagcggcaagtacgttaatacttcactgaacaatttccaaaatgcaatgaatata
tcatgctattctttcactgccttagcacagagggctgaaaaaatgatgccaaatggcggc
agtttacttactttatcttattatggtgctgaaaaagttatgccaaattataacgtcatg
ggcttgtgtaaagcagcacttgaagcaagtgtaaagtatctagcatgtgacttgggtcca
caaaacatcagagtaaatgccatttctgctggtccaatcagaactttagcgtcttctgga
ataagtgattttcacttcatatcagaatggaacagaaataattctcctcttagacgcaac
actactcttgaggatgttggaaaagcagcactatatttattaagtgacctaagtagtggt
actaccggagaaattttacatgttgattcaggatataatgttgtagggatgaaggcaatt
gattcaaatataattaatagctaccaaaattga

DBGET integrated database retrieval system