KEGG   Wolbachia wBm (Brugia malayi): Wbm0570Help
Entry
Wbm0570           CDS       T00234                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00550  Peptidoglycan biosynthesis
wbm01100  Metabolic pathways
wbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Wbm0570
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Wbm0570
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Wbm0570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wbm01011]
    Wbm0570
Enzymes [BR:wbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Wbm0570
Peptidoglycan biosynthesis and degradation proteins [BR:wbm01011]
 Precursor biosynthesis
  Amino acid ligase
   Wbm0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AAW71158
UniProt: Q5GS66
LinkDB All DBs
Position
748388..749407
Genome map
AA seq 339 aa AA seqDB search
MYVVIINIVLLKVLMVLTITILSGGFSRERKISLMSGKAVKKALDSLSYNAIEIDVNSNT
AEKLKKINPDLAFIALHGPYGEDGCIQGLLEILGIKYTHSGVMASAIAMNKAMSKHIFRS
LGIDTPKGYIISRGDILKNNIKIDYPYVLKPINEGSSIGVHITFSHEDYLKLKNMFSVIP
VHDAGIEEEEPVWITRDLMIIEEYIPGIELHTAVLLDEAAGTMEIRPKNKFYDYKAKYTN
GFAEHIFPAEIPDNIYEMTLEHALKVHRFLGCKTISRSDFRYNPKDNTLKMLEINTHPGF
TELSLVPEIAKLTKGIDFNELVKIIIEDSLQHKKILEIK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtagtcataattaatatagttcttctaaaagtgcttatggtcctaactataaca
attttaagcggtggattttctcgtgaaaggaaaatatcattgatgagtggaaaagcagta
aagaaggcgcttgatagcctttcatataatgcaatagaaatagacgttaacagcaacact
gctgaaaagcttaaaaaaattaatcctgaccttgcttttattgctctacatgggccttat
ggcgaagatggctgcattcaaggtttattggagatcttaggtataaaatatacacactct
ggagttatggcttcagctattgctatgaataaagcaatgtctaagcatatattccgatcc
cttggtattgatactccaaaagggtacataatcagtcgaggagatatactaaaaaataat
attaaaattgattatccatatgtcttaaaacccattaatgaaggttcaagtattggagtg
cacataactttctcgcatgaggattatttaaaattaaaaaacatgtttagtgtcattcca
gtgcatgacgctggaattgaggaagaagaaccagtttggataacaagagatttgatgatc
atagaagaatacataccaggtatagagttacacactgccgtgttactagatgaagcagct
ggcactatggaaataagaccaaaaaataaattctatgactataaagcaaaatacacaaac
gggtttgcagagcacatatttcctgctgaaattcctgacaacatatatgaaatgaccttg
gaacatgcattgaaagttcatcgatttctaggatgtaaaactatttctcgctcagatttt
cgctataatcctaaggataatactctaaaaatgcttgagatcaatacacaccctggcttt
actgaattatcgttagtaccagaaattgcaaaattgacaaaaggaattgattttaatgaa
ttagttaaaattattattgaagatagtctacagcacaaaaaaatattagagatcaagtaa

DBGET integrated database retrieval system