KEGG   Wolbachia wBm (Brugia malayi): Wbm0600Help
Entry
Wbm0600           CDS       T00234                                 

Definition
(GenBank) Succinate dehydrogenase Fe-S protein, SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00020  Citrate cycle (TCA cycle)
wbm00190  Oxidative phosphorylation
wbm00650  Butanoate metabolism
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01120  Microbial metabolism in diverse environments
wbm01130  Biosynthesis of antibiotics
wbm01200  Carbon metabolism
Module
wbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wbm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Wbm0600
   00650 Butanoate metabolism
    Wbm0600
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Wbm0600
Enzymes [BR:wbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Wbm0600
    1.3.5.4  fumarate reductase (quinol)
     Wbm0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AAW71188
UniProt: Q5GS36
LinkDB All DBs
Position
complement(785758..786546)
Genome map
AA seq 262 aa AA seqDB search
MVQFFLPKNSKINKKGKVYPAPTKAKNVRRFQIYRWSADDKKNPRVDTFFIDMDNCGSMV
LDALIKIKDEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKSIPDIKGDVKIYPLPHM
YVIKDLVSDLSQFYEQYKSVNPWLQADKPNLLNQEYSQSPEDRKKLDGLSDCILCACCST
GCPNYWWNNDKFLGPAILLQAYRWIADSRDNKTDERLDALNDPFKLYRCHTIMSCTKTCP
KGLNPAKAIAKIKQLMVERKGF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggttcagttttttttgccaaaaaattctaaaattaataaaaagggcaaggtttaccct
gctcctactaaagcgaaaaatgttaggagatttcaaatttaccgttggtctgctgatgac
aaaaaaaatcctagagtagacacgtttttcattgatatggataattgtggctctatggtg
cttgatgcattgataaaaataaaggatgaaatagatcctaccttaacttttagacgttct
tgcagagaaggaatatgtgggtcttgtgctatgaatattgatgggaccaatactcttgca
tgtactaaatctataccagatataaagggtgatgtaaaaatatatccattacctcatatg
tatgtaataaaagatctagtttcagacttgagccaattttatgagcaatataagtcagtt
aatccttggttacaggcagataagcctaacctgctaaatcaagaatattcgcaatctcct
gaagatagaaaaaaactggatggcctttctgattgtatattatgtgcttgctgctcgact
ggttgtccaaactattggtggaataatgataaatttttaggaccagcaatactattacaa
gcttacagatggattgctgatagtcgtgataataaaacagatgaaagacttgatgcctta
aatgacccatttaagttgtatcgttgtcatacaataatgagttgcacaaaaacctgccct
aaagggcttaatccagcaaaagcaatagcgaaaataaaacagcttatggtagagagaaaa
ggattttaa

DBGET integrated database retrieval system