KEGG   Wolbachia wBm (Brugia malayi): Wbm0674Help
Entry
Wbm0674           CDS       T00234                                 

Definition
(GenBank) Malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00620  Pyruvate metabolism
wbm01100  Metabolic pathways
wbm01120  Microbial metabolism in diverse environments
wbm01200  Carbon metabolism
Module
wbm_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Wbm0674
Enzymes [BR:wbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Wbm0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog ThiF AlaDh_PNT_C DXP_synthase_N PglD_N
Motif
Other DBs
NCBI-ProteinID: AAW71262
UniProt: Q5GRW2
LinkDB All DBs
Position
881171..882520
Genome map
AA seq 449 aa AA seqDB search
MNSKYKDVMMNDDLDSTTKQEALKYHIRGGNPGKISILPTKSLSTQYDLSLAYSPGVAAP
CLEIAKNPDVVYDYTAKSNCVAVISNGTAVLGLGNIGPLASKPVMEGKAMLFKRFADIDA
VDIEVDTENIEDFINAVRYLGPSWGGINLEDIRSPDCFIIEKRLNELMDIPVFHDDQHGT
AVVVAAGIENALDIAGKKLEDVKIIMNGAGAAGIACLEILKSMGAKNIVLCDKQGVIYKG
RNEDMNEWKEKYATDTKERSLLDAIKDTDVFIGLSAKDALNEEMLKNMGQNPIIFALANP
DPEVRPELAKSVRPDAIIATGRSDYNNQVNNVMGFPYIFRGALDVHAMTINNEMKIAAAD
AIAKLAREPAPDEISAVYGGRKMSYGREYIIPTPFDPRLVSIVSPAVAKAAVCSGVAKKE
IQDWSKYANQLKSRLANALNTLNLLSSQY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaaatataaggatgtaatgatgaatgatgatttagatagtacaacaaaacaa
gaggcacttaagtatcacattagaggtggcaatcctggtaaaatatccatcttgccaaca
aaatctttgtctactcagtatgacttgtcacttgcctattctcctggagttgcagctcca
tgccttgaaatagccaaaaatcctgatgtggtctatgactatacggcaaaaagcaactgt
gttgctgttatttcaaacggcactgcagtacttgggctcggcaatattggtcctcttgcc
tcaaaacctgttatggaaggcaaagctatgctgtttaagcgtttcgctgatattgacgca
gttgatatagaagtcgatacagaaaatatagaagactttatcaatgcagtaagatacctt
gggccaagctggggaggaataaatttagaggatataagatcccccgattgttttataata
gagaaacgtctgaatgaattaatggacattccagtgtttcacgatgaccaacatggaact
gcagtggttgttgcagctggcatagaaaatgctcttgatattgctggaaagaaattagag
gacgttaagatcatcatgaatggtgctggagcagccggtattgcatgtttagaaatactc
aagtccatgggcgctaaaaatatagtgctatgtgataaacaaggagtaatatacaaaggt
agaaatgaggacatgaatgagtggaaggaaaaatacgcaactgatactaaagaacgttct
ctacttgatgcaataaaagacactgatgtatttatcgggctatctgcaaaggatgcatta
aatgaagagatgttaaaaaacatgggtcaaaacccaattatttttgctcttgctaatcct
gacccagaagtaaggcctgagcttgcaaaatctgtgaggccagacgcaataattgcaact
ggtagatcagattataacaaccaagttaacaacgtaatggggtttccttatatattcaga
ggagcactcgatgtacatgcaatgacaataaataatgaaatgaaaatcgcagctgcagat
gcaatagcaaagctcgctcgtgaaccagcacctgacgagatatctgcagtctatggtggc
cgtaaaatgagctacggacgtgaatacataatacctaccccttttgacccaagactagtt
tctatagtatctcctgccgttgcaaaagctgcagtttgctcaggtgttgcaaaaaaggaa
atacaagattggagcaaatatgcaaatcaattaaaatctcgtcttgctaatgctcttaac
acgctgaacctattgtcctcacaatattag

DBGET integrated database retrieval system