KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): accCHelp
Entry
accC              CDS       T00101                                 

Definition
(GenBank) Fatty acid and phospholipid metabolism
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
wbr00061  Fatty acid biosynthesis
wbr00620  Pyruvate metabolism
wbr00640  Propanoate metabolism
wbr01100  Metabolic pathways
wbr01110  Biosynthesis of secondary metabolites
wbr01120  Microbial metabolism in diverse environments
wbr01130  Biosynthesis of antibiotics
wbr01200  Carbon metabolism
wbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:wbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    accC
   00640 Propanoate metabolism
    accC
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    accC
Enzymes [BR:wbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     accC
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     accC
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 RimK ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAC24749
UniProt: Q8D1V3
LinkDB All DBs
Position
679455..680792
Genome map
AA seq 445 aa AA seqDB search
MFNKVLIANRGEIALRVLRACKELNIKTVAVYSTSDRFLKHVLLADETICIGPANSLESY
LNIPSIISAAEITGSDAIHPGYGFLSENYNFAEQVEKSGFIFIGPNSNTLKLMGDKISAI
SVMKKIGMPCLPTSFNISKNNIKKNTFIANKIGYPIVIKASKGGGGRAMKIVYKNSELED
SICISKSESKIAFNDDSLYFEKYIENAKHIEIQVLSDGHGNAEYLVERDCSIQRRYQKIL
EESPSVYLNKKIRNYLGKFCIKACLLINYKGVGTFEFLYKDKNFYFIEMNTRIQVEHPVT
EMVTGIDIVKEQLKIAYGEKLNLKNKINFSGHAIECRINAEDPKTFLPNYGKISRFHAPG
GLGVRWESHIYSGYNVPAFYDTLIGKLICFGENRKIAISKMKNALEEIIVDGIKTNINLH
LKIINNKDFLDGDKININFLSNFNF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaagtattgattgctaacagaggagaaatagctttaagagttttgcgagct
tgtaaagaattaaatataaaaacagtagctgtgtattctacttcggatagatttctaaag
catgttttattagcagatgaaactatttgtataggtccagcaaactctttagaaagttat
ttaaatattccatctattatatcagcagcagaaatcactggatctgatgcaatacatccc
ggatatggatttttatccgaaaattataattttgcagaacaagtagagaaatctggattt
atatttataggtccaaattcaaatactttaaaacttatgggtgataaaatatctgctatt
tcagttatgaaaaaaataggaatgccatgcttgcctacatcttttaatatatctaaaaat
aatatcaaaaagaatacttttattgctaataaaataggatatcctattgtaataaaagct
tcaaaaggaggtggcgggagagctatgaaaatagtttataaaaattccgaattggaagat
tctatttgcatatcaaaatcagaatctaaaatcgcatttaatgatgatagtttgtatttt
gaaaaatatattgaaaatgctaaacatatagagattcaggttttatctgatggacatgga
aatgcagaatatttagtagaaagagattgttcaatacagcgtcgttatcaaaaaatttta
gaagaatcaccttctgtttatttgaataaaaaaattagaaattatttaggaaaattttgc
ataaaagcttgtttgcttattaattataaaggagtaggtacttttgagttcttatataaa
gataaaaatttttactttatagagatgaatacaagaattcaagtagaacatccagttaca
gaaatggtaacaggaatagatatagttaaagagcaattaaaaattgcttatggagaaaag
cttaatttaaaaaacaaaattaatttttctggacatgctatagaatgcagaataaatgca
gaagatcctaaaacttttttacccaattatggaaaaattagtagatttcatgcaccaggc
ggtcttggtgttagatgggagtctcatatatattcaggttataatgttcctgctttttat
gatactttaatcggaaaacttatttgttttggagaaaatagaaaaatagcaatctcgaaa
atgaaaaatgctttagaagaaattattgtagatgggataaaaactaatattaatttacat
ttaaaaataataaataacaaagattttttagatggagataaaattaatattaatttttta
tctaattttaatttttaa

DBGET integrated database retrieval system