KEGG   Weissella cibaria: AO080_12025Help
Entry
AO080_12025       CDS       T04106                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
wcb  Weissella cibaria
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH ADH_zinc_N_2 NAD_binding_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ALI34166
UniProt: A0A0D1LY90
LinkDB All DBs
Position
pMKC02:complement(6759..7775)
Genome map
AA seq 338 aa AA seqDB search
MEALVLTGTNKLEVKSIEKPEVKPNEVLIHTAFAGICGTDHALYAGLPGSADAVPPIVLG
HENSGVVAEIGSSVTNVKVGDRVTVDPNIYCGQCKYCRTGRPELCENLSAVGVTRNGGFE
EYFTAPASVVYQIPDNVSLKSAAVVEPISCAVHGIKLLKVTPYQKALVIGDGFMGELFVQ
LLQAYGIHQVDLAGIVPEKLAMNKEKFGVKNTYNTKDGDKIPEGEYDVVIEAVGLPQTQE
AAIEASARGAQVLMFGVGGPDAKFQMNTYEVFQKQLTIQGSFINPNSFEDSLALLSSGKL
NVEDLMSHELDYKTVEDFVNGKLGVVSKAVVKVGGEEA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacttgtgttaactggtacaaacaaattagaggttaaaagcattgaaaaacct
gaggttaagcccaatgaagttttgattcatacagcattcgctggtatttgtggtactgat
catgctttgtatgccggccttcccggctcagcagatgctgtaccaccaattgttttgggt
catgaaaattccggtgttgtagctgagattggttcatccgttacaaacgttaaggtagga
gaccgtgtgacggttgatcctaatatttactgcggtcaatgcaagtattgccgtacggga
cgcccagaactttgcgaaaacttgtcggctgttggtgttacacgtaatggtggatttgag
gaatactttacggcacctgcatcagttgtttaccaaattcctgataatgtgtcattgaag
tcagctgctgtggttgaacctatttcatgtgcagtgcacggaattaagttgcttaaagta
acaccatatcaaaaagctttagttattggtgatggatttatgggtgaactatttgttcaa
cttttgcaagcttatggcattcaccaagtcgatttggccggtattgttcctgaaaagctt
gctatgaataaagaaaagtttggcgtgaaaaacacctacaataccaaagatggtgataaa
attcctgagggcgaatatgacgttgttattgaagccgttggtttgccacaaacacaagaa
gcagccattgaggcttcagcccgtggtgctcaagttttgatgtttggtgttggcggtcct
gacgcaaagttccaaatgaacacttatgaagtcttccaaaagcaattgacgattcaagga
tcatttatcaatccaaattcctttgaagattcattggcattgttgtcatcaggcaagttg
aatgttgaggatttgatgtcacatgaattagactacaagactgttgaagattttgttaac
ggtaagcttggtgtcgtttccaaagctgtggttaaggttggcggagaagaggcgtaa

DBGET integrated database retrieval system