KEGG   Weissella confusa: C6P13_07195Help
Entry
C6P13_07195       CDS       T05951                                 

Definition
(GenBank) mucus-binding protein
Organism
wcf  Weissella confusa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MucBP_2 Mub_B2 Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: QBZ03057
LinkDB All DBs
Position
complement(1485401..1502827)
Genome map
AA seq 5808 aa AA seqDB search
MKSTDTSVKEREINLEDAGGGNKKNKQWLRFGATSLLIAIGMGANIGGDISASEETTIDD
ADASLVSSSDKDDDQDIEERDKDGDGLDDETGEPVPTNPSDPESVVASAEATASEASVAE
SVAETPVDPVVVESASSETSSLPEESVTSSTAEVSDSESVVQSPVTSQSSLASSVVLSTT
SAASESSAESTDASSEASQTDSDSLVSVAPSSEASSATSDEESSASDSLVSVAPESESDT
LTSVAPESEAESSSAESAMSSADSLQSVAPSSSQSATVLGSADSTTEETETVPDGITVPV
NTTIEIPNAESFTGSDYGLSSTVTVTYVDKYLWINLPEVYNFNSIDMDALKAYAVRNRMV
ISFLQEGEHEKDSTTGLTEAQQATFDLFNKASFNLMPETEVTNDDGTIIVYWPDSTEAST
TFDSVDHDDIRVWAETNGLGWVVASEAWRRINTGQTPPAGDQVLDTSSSGLPNIIKNDAN
LLRTYFPLQYFLSASGKVQYVVLMAREGTTRDPWGTTIKGGETLMIAEFTSTGIIRTNYI
NNGQVLTLNGTTITNRFSAGSGDYNITNYYNENGTTLQSWTMQGITTKSTLADANYYYAI
DNGDGTYTKTDIRIPVNTSAGSTGDAKVNTLTGGSGGSFPDEYIITSDVLSGYQLVPSLT
YASGQMSSTTTGSGTGMTQTVRGKFMTNVYDQMTKSGANMYRTVLDPNNPFNLALVRAYG
FDLSKVPVGAVVDKYVNSSGGYTVTIAWPVVDANGNETGQTSIIWDTGSNTIRFDTSASG
GAATNPVKHYTIPTSPLTFYLQTNTSTGATSIVAATSQPTTSGYTFAKITGDIYKTTTGT
LTFSATDAFGNANTVVSTPDWLDEDRNGSIDGGSFTGFKNGGYGDKQNSFTIIGKFNVSG
VNFYYVAAPQMATVGLKTAEKQSDGTYKLVDTARTNTDGVSNYNNKTSGQKDSALQGVTG
AVIGVARTESTANDWAKINTKVPGYTYIGYTYNGGALQSVQKTDGTYAMPYENSNAKYNA
TASTSVSNGAITDSSADAIVLYYAIDSQQAQIKFVMADGTTAPANINLTGKTGEALSQDI
ASSIPAGYHIDTSKTTTTGSPAMTLSGTTVSGTYDATNNNLSTTDSSLQTMTITLVADTQ
TVKVRYIDVNASDKTTGWTADDGTEITDWVQTVTGDTGKTYTNVPWGMSTTGYVVVAQDA
GTRSGTFDNDTNTDQTYYVYLKHNTVSVEGGKEGNATWTTRSTVRYRYEDGTTAAAANVR
TITFTATVTYDAVTGEALYDTWDAESYTFDDVESPVIQGYIADKLQAGSGTVTNTSAGIV
AIVEYKALGAWTPDFPDTTPDNPPTDVTYPNDPDDPTQPDRTNPSVPVVPYVPGYTPEGP
NSTPLTPVNPDDPTAGYLPPDVPDDPTADTTIVYHANDQKVTVNYIYVADDGIRTQVHTE
SFSGKSNADYTHELWGYETNPDQSYVLVSKDAGAESGKFDADDDTDQVYNVILAIGTESV
PGGKTDDPNYTDYTKTITRTIKYVDQDGNQMVDANGNLVPDSFMEHTFTATVTYKVNSSV
PVSVEWPNDSATFAAVKSPVITGYVADVTQVDADQIDHNDSPTTYTVTYKPMGSWTPSFP
PNTENVPSDPIQYPNDPNNPTDNETPHDPAEPGDPVIPYVPGYTPEGPDGTPLKPVDPEN
PSAGYIPPAPTDPTGDTTINYTRNTQQVIVRYIDDTTNLEVTELRQTFSGETDQAYTNTL
SDYATLGYTFVSAEAGATAGTYDRDDAATQTYTVHLNHGTVVVEGGREDDPNHGSYTSTV
TSTVHYIYEADNSTAEPDSVQKKTFTASVTYDAVTGEVVSIVWPTESQNFDDVQTPVIDG
YFASEGVVAGGAVDYNDASREETVTYTKLGSWIPHVPDLPEDEQLKTRVYPNDPNDASKV
WTRDDPNYVEVPVPYIPGYTPTTDGSSTPLEQIDPNDVTKGYYPPDVPDNPAADTPIYYV
AHPQTLVVYVDISSGTEVEVTELQQTLTGTTNAAYTNTLSDYAARGYVLVNQDATATEGT
YDDADNVTQFAKVYLDHGTVIVTPDNPGDPGNPMYPDVPGTPTWPGGTDLDGVKQTINGV
INYQYENGDEAFPDVTRTVTFERSITLDAVTGEQISTTDWVVTAGDDDWPETPSPVKEGY
YADISDILAVTIAPGDFDRSYMVTYYPMGQYVPVFPEGTENVPSDPITYPNDPDNPGDPL
EPGEGTPATPGDSDNPTLPYVPGFTPEGPDGTPLEPVDPNNPSAGYWPPATPTDNPGGDT
TITYTANEQKATVTFIDDTTGDTLKVVDLTGKSDETDAYRTATDIATYERAGYVLVSDDY
PTDGVVYDRVDDEDQPFTVHLKQATVTVDPSSPKEPGTDIFTPGDPVDPDNPSGPTWPAT
PTYPSGVTKDDLNQTVTRTITYTYASNGEKASETVTETLTYSRTATVNAVTGAVTYGAWQ
TTDSTLDKVDSPLISGYVASQLTVAEEADVDAMADDTTVAITYTKLGQWVPSFPPSAADE
DVPDDPIDYPNNPSDPTEPLEPGVNNPNDPGTPANPTLPYVPGYTPEGPDGTPLTPVDPD
NPSAGYWPPETPTDKPGDDTVIHYVANDQAARITFIDDDTKLELAVDTISGESSDTSTYT
TADRIKAYEAQGYTLVSDDFPADFQFDRDDATEQKFEVHLKRTVLVITPDDPRTPSDPIF
TPGEPVDPSDPSSPTYPAEPGTPGEPIDPANPSGPTWPETPTYPAGLTAEDLNQTVNLTV
NYVYEDGTTGAHDPHTDAVHFTRTATLDTVTGEVTYSDWVAVNDDDLLDTYKSPVIDGYY
ADKAYSTAVTVAAEDGDVTETVTYKKLGQWVPSFPATTPSAPTDPIDYPNNPSDPTVPTD
PAENPSEPGTPENPTLPYVPGYTPEGPDGEPLTPADPSNPSSGYLPPNPTNPGEDTVITY
VPADQVGSVTYVDATTGTTLSVDPLAGKSDEPGTYATADRIKQYEAMGYVLVTDGYPTDF
TFDSDTAKSQDFTVTLKQVTVVVTPDDPKNPSDPIFTPGDPVDPSDPSSPTYPEEPGTPG
DPIDPNNPSGPTWPATPTYPSGVTAQDLNKTVTRTITYVYENGSEAATTVTDNVVFERTA
TVNAVTGEVTYGEWTAVGDDVDWQQVDSPMIVGYMADKASVEFVDVTGATESTSVVVTYT
AVGQWVPHFPPGTEDVPSDPINYPNNPDDPTNPADPGPDNPADPGTTDNPTLPYVPGFTP
QGPDGEPLEPVNPSNPSEGYWPPVIPDDPKQSQDITYTANEQTARIVFIDDTTGTTLATD
DIDGVSDEKSTYTTADRLAAYYAQGYTLVSDGYPADFAFDRVDGNVETFEVHLKHAAITV
TPDDPKNPSTPIYTPGDPVDPSDPSSPTYPAEPGTPGDPIDPDNPSGPTWPAVPTYPAGV
TTTDLNETVNRTITYVDEAGNTVFDAATDKVSFTRTATVDAVTGEVTYGAWVATGNDTTF
DAVSSPVKTGYYADKEVVAETTGLTATTGDETVQVVYKPMGQWVPSFPAGTENVPSDPTT
YPNDPAHADTPLEPGDSNTNVPGTPDNPTMPYVPGFTPQGPDGTPLEPVTPGSPEGGYWP
PATPTDNPGGDTVVTYVADEQKATITYHDVTTDTDLSVDTIDGHSDETSSYTTAQRIAMY
EQQGYRLVNDGYPGTDFTFDRDTATDQAFIVQLERITQTITPDDPKTPSSPIFTPGDPVD
PSDPSSPTYPEQPGTPGEPIDPDNPSGPTWPATPTYPAGLEHDDLNQTVTREVTYVYDRD
GSEAATTATETLTFTRTATLDTVSGDITYGDWIAADSDTTFDEVTSPTIAGYTANRASVA
EATGVAATDADTSIEVRYVANEQHATITYIDDNTQQTIVMDDITGQSDGTTTYTTADRIA
ALQAQGYSLVSDGWPADFVFDTDDDTTQAFEVHLKHATITIDPDDPKTPSSPVYTPGDPV
DPDDPDGPTYPAEPGTPGEPIDPNNPSGPTWPATPTYPDGLKTTDLNESVDRTITYVYEN
GNEAAETVTDNVQFTRTAEYDVVTGTVTYGEWVATNGDTTFDAVESPVITGYYADLTQVD
ETANLTADSGDENVKVTYKQMGQWVPSFPANTPSVPTDPITYPNDPDDPTQPLEPGAPDY
PVVPYVPGFTPEGPDGPLQPVDPTDPSKGYVPPATPTDNPGEDTTINYVANEQTATITFI
DDTTKTNLAVDTITGVSDATSTYTTAERIQAYLAQGYTLVSDGYPTDFTFDRDDSKTQAY
EVHLKHATITITPSDPKTPSQPIYNPGDPVDPSDPDSPTYPEQPGTPGEPIDPDNPSGPT
WPATPTYPAGLTETDLNESVTQTITYVYADGQEASDPKADTVTFSRTATLDPVTGAVTYG
EWIAANSDTTFDAVASPVITGYVADKQTVAEVTGIQATDADTDPVVTYTAMGQWVPSYPA
GTPDVPTDPITYPNDPDDPTQPADPTAPNYPVIPDVPGFTPQGPDGPLQPVDPSDPSKGY
VPPATPTDPTQDTTITYVANEQQATITYLDQTTGKQLAMDTITGHSDETSTYTTADKIAA
YEAAGYVLVTDGYPGVNFTFDREDDYDQTYEVIFIHAVITVDPNDPKTPSSPIFTPGGPV
DPDDPTSPTYPVNPGDTPTPTYPGGLTETDLNESVTQTITYKYADGSTAADDATDTVTFS
RTAKVDAVTGTVTYGDWVAANEDTTFDAVDSPVITGYVADKQTVATVTGIGAKDADTTVN
VVYNKMGQWVPSFPADTTNVPSDPMTYPNNPDDPTEPLTPGPENETDPGDPDNPTLPYVP
GFTPQGPDGEPLDPVDPSNPSSGYWPPTLPSDPTTDTTIEYKADEQEATITYIDEVTGDT
LVVDTIKGGSDESSTYTTADRLADYLANGYALVADEYPTDFTFDRDTTVTQAYKVTLTHG
SQTIDPNDPKTPGTPINPDNPDGPKYPDGLKSTDLNESVTRTITYVDQAGKTMATAVEET
IHFTRTATLDTVTGSYTYSAWVPTTVTSMDAVDSPVIAGYVADRQTVAALPDLTATSADV
SEKVVYSPIGQYVPSFPSGVTDVPSTPIDYPNNPDDPTTTDTPGEDNPATPGTPDNPTMP
YVPGFTPQGPDGEPLDPVDPDNPSSGYWPPAPSETPTEDTTITYTANKQTATITYINDET
GSVLAVDTITGGSAETSTYTAYNRIMVYKLAGMMLVSNGYPSHFTFDRDETVDQAFEVHF
KGATITVTPDDPKVPGDPIYQPGDLIDPNDPDSPTFPDPLGEPGTPVDPDDPDSPTWPQP
PVWPDGVTAEDLREEVNQTITYIYEKDGSTAAKTVTDQVVFTRTITINVIAAQESAQPRA
RLARAATSSAIVYSDWQAVNGDDTFDAKTSPVIPGYIADRLVVDEVAGMDETSEDDIQQV
VYRQLGSWVPSVPQVPGVKTPGEVTYPNDPDDPTKTADPNSPGYPVIPYVPGFTPQGPDG
TPLQPVDPKNPSKVYLPPAVPSDPTADTTIVYTVDRQHAKVNFIDQNTKQVLHVEQLSGD
SYSKSSYTTAEQIAYYVAQGYVLVRDGYPAGGMTFDADSTLNQTFAVTLAHGTKTVDPNN
PGVPGTPIDPNNPDGPKWPAGVDEDHLKTSTTRTIIFRTSDGTIVDTKTQIVTYTRTATV
DTVTGEVTYGPWTAEDGSHVPDAAVPGMPGYVADRDLVPGVDIPVGTPNFTEYVTYTVVP
EQTTAEVGPNEPVIVPEVLTPHSLAYTAVQSATATTESAASLAYTAEQSAAESATAQHSG
VLPYTGSDEQEGAKATGLAMLFGLFLGLFKRRKRKDEAEETSKKHDDK
NT seq 17427 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctacagacacaagtgtaaaggagcgagaaattaatctcgaagatgccggtggt
ggcaataagaagaataagcagtggcttcgttttggtgcgacgtcattgttgattgccatt
ggtatgggggccaatataggtggcgacatttcagcgtcagaagagacaacaattgacgat
gctgatgcttctttggtgagctcatctgacaaggatgacgaccaagatattgaagaacgt
gataaggatggcgacggtttagacgatgagaccggggaaccagttccgactaatcctagt
gatccggagtcagtcgtggctagcgcagaagctacggcatctgaagcatcggtcgctgaa
tcggtggccgaaacgccagttgatccagttgtagtggagagtgcgagttctgaaacgagc
agtctacctgaagagagtgttacctcaagcactgcagaagttagtgatagtgaatcagtt
gtccaatcaccggtcacaagccaaagttcattggctagttcggtggttttgtcgaccaca
tctgcagcttcagaaagttcggctgagtcaactgatgcgtctagcgaggcaagtcaaacg
gattctgacagcttagtgagtgttgcaccatcaagcgaagcaagtagtgcgacaagtgat
gaggagtcaagcgcatctgatagtttggtgagcgtggcacctgagagcgagtcggacacc
ttgactagtgttgcacctgaaagtgaagctgagtcatcttcagctgaatcagcaatgagt
agcgcagactcgttgcaatcggttgcaccatcgagctcacaatcagcaactgttctggga
tcagctgatagtacgactgaagaaacggaaacagttcctgatgggataactgttccggtt
aacacaactatcgagattccgaatgctgaaagctttacgggatcagactatggactaagt
agtacggttacggtcacgtatgttgacaagtacctgtggattaatttgccagaagtgtac
aacttcaacagcattgatatggacgctttgaaggcctatgccgttcgtaaccgcatggta
atttcgttcttgcaagaaggcgagcacgagaaggattcgacgaccggattgactgaagca
caacaagcaacgtttgatttgtttaataaagcgtcgtttaacttgatgccagaaactgaa
gtaacaaatgacgatggcacaattattgtctactggccagactctacggaagctagcacc
accttcgattcagtcgatcacgacgatattcgtgtgtgggctgagactaatggcttgggt
tgggtagttgcatctgaggcgtggcgtcgtattaatacggggcaaacaccacccgctggt
gaccaagttctggacactagtagttcaggattgccaaacattattaaaaatgatgcgaat
ttgctacgaacttatttcccactgcagtatttccttagtgcctcaggtaaagtgcaatat
gtcgtattgatggcgcgcgaaggaacgactagagacccatggggaactaccatcaagggt
ggtgaaacgttgatgattgccgaatttacatcgacaggaattattcgtacaaactacatt
aataacggtcaagtactaacgttaaacggaaccacaatcacgaatagattttcagctggt
agtggtgattacaatataacgaattactacaacgaaaatggtacaactttgcaatcatgg
acgatgcaaggaataacgactaagtcaaccttggccgatgccaactactactatgccatc
gataatggtgatgggacgtacaccaagacggacattcgtattccagtgaatacaagtgct
ggttcaactggtgatgccaaggttaatacgttgaccggtggatctggtggttctttccca
gatgaatacatcatcacttctgacgtgttgtcagggtaccagcttgtgccatcattaact
tatgcttcaggccaaatgtcttctacaacaactggctcaggcacaggaatgacacaaacg
gtgcgtggaaagtttatgacgaacgtatacgatcagatgaccaagtctggtgcgaacatg
tatcgtacagtacttgatccaaacaacccatttaatttggcgttggttcgtgcgtatggc
tttgatctgagcaaggtgccagtcggtgcggtggtcgacaagtacgtcaacagtagtggc
ggttatacggtcacaatcgcttggccggttgttgatgctaatggtaatgaaaccgggcaa
acgtcgattatttgggatactggttcgaacacaattcgttttgatacgagtgccagtggt
ggggccgcaacaaacccagttaagcactatacgattccgacttctccactaacattctat
ctacaaacaaatacgtcgaccggtgcgacttcaattgttgctgcaacgtcacaaccaact
acatcgggttatacatttgccaagattactggtgatatctataaaacgactactggaacg
ctaactttttctgcgaccgatgcatttggaaacgcgaatacagttgtttctacaccagat
tggttagacgaagatcgtaacggatcaatcgatggtggtagtttcaccggctttaagaat
ggcggttatggtgataagcaaaacagtttcacgattatcggaaagtttaacgtttccggc
gttaacttctactatgttgctgcaccacaaatggcaacagttgggttgaagacggccgaa
aagcaatcagatggcacgtataagttggtcgatactgcccgaactaatacggatggtgtt
tcaaactataataataagacgtctggtcaaaaagactcagccttgcaaggtgtgacaggt
gccgtcattggtgttgctcgaacagaaagcacggctaatgattgggcgaaaattaatacc
aaggtgccaggttatacctacattgggtatacgtataacggtggcgcactgcaatcggtt
caaaaaacagatggtacttatgccatgccgtatgaaaattcaaatgcgaaatacaacgcg
actgcaagtacgagcgtttcgaatggtgcgattacggactcatcagcggatgcgattgtc
ttgtactatgccatcgatagccaacaagctcaaattaagtttgtgatggccgatggaacg
acagcaccagcaaacatcaatttgactggtaagactggtgaagccttgtcacaagacatc
gcaagcagtattccagctggataccacatcgatacaagtaagacgacaaccactggttca
ccagccatgacgttatctggtacgacagtttctggtacgtatgatgccacgaataacaat
ttgagtacgactgatagtagtttgcaaacaatgacgattaccttggttgctgacacacaa
acggttaaggtacgttatattgacgttaacgcgtcagataaaacaactggctggacggca
gacgatggaaccgaaatcactgattgggtgcaaacggtaactggtgacactggtaagacg
tataccaatgtgccgtggggaatgtcgacgactggatacgttgttgtggcgcaagatgcc
ggaacgcgttctggaacctttgataacgatactaatacagaccaaacttactacgtttac
ttgaagcacaacactgtgagtgtggaaggtggtaaggaaggaaatgcaacgtggacgacg
aggtcgacggttcgttatcgctatgaagatggcacaacggccgcggcggctaatgttcga
acgataacatttacagctaccgtaacgtacgatgcggtcacaggtgaagcgctatacgat
acgtgggatgctgaaagctatacatttgatgatgtggaatctccggtcattcaaggatac
attgctgacaagctacaggctggatcagggactgtcactaatacctctgctggcatcgtg
gcaattgtcgaatataaggcattgggtgcttggacaccagatttcccagacacaacgccg
gataatccgccaactgatgtaacctatccaaatgatccggatgatccaacgcaacctgat
cgtacgaatccttctgtaccggtggtaccttatgtacctggttatacaccagaaggacca
aacagtacgccgttgacgccggttaatccagatgatccaacggctggttatttgccacca
gatgtaccggatgatccaacggctgatacgaccattgtttaccatgcaaatgatcaaaaa
gtaacggttaactatatttacgttgcggacgatggtatacgtacacaagtgcataccgaa
tcgtttagtggcaaatcgaatgcggactatacccacgaattgtgggggtatgagactaat
cctgaccaatcttatgtgctggtatctaaggacgcgggtgctgagagtggtaagttcgat
gccgatgatgatactgatcaggtttataacgttattttggcgattggaacggaatcggta
ccaggtggtaagacggatgatccgaactatactgattacactaagacgattacgcgtacg
attaagtatgtcgaccaagacggcaatcaaatggtggatgctaatggtaatctagtgcca
gatagtttcatggagcacacatttacagcaacggttacctataaggtaaattcaagcgtg
ccggtttcggttgaatggcctaacgattcggcaacgtttgcagcggttaagagcccggtt
attacggggtacgtcgctgatgtaacgcaagttgatgcggatcaaattgatcacaatgac
agtcctacgacgtacacggtcacatataagccaatgggaagttggacgccaagtttccca
ccaaatactgaaaatgtaccgagtgatccaattcaatatccaaacgatccaaataatcca
acggataatgaaacgccgcatgaccccgctgagccaggtgacccagttattccgtatgta
ccgggttacacgccggaaggacctgatggcacaccattgaagccggtcgacccagaaaat
ccatcagctggttatattccaccagctccaacggatccaacaggtgatacgacaattaat
tacacgcgtaatacgcaacaagtcattgttcgttatatcgacgatacgactaatttggag
gtaactgaacttcgtcaaacgttctcgggtgagactgatcaggcctatacgaatacgttg
tctgattatgcaacgcttggttatacgtttgttagcgcagaagcaggtgctactgctgga
acgtatgaccgtgacgatgcagcgacacaaacttatacggttcacctgaatcacggaact
gtggtggtagaaggtggtcgtgaagatgatccgaaccatggtagttatacgtctacggtt
acgtcaacagttcattatatttatgaagctgataattcgacagctgagccggatagtgta
cagaaaaagacgtttaccgcatcagtgacttatgacgcagtgacgggcgaagtggtgtca
attgtgtggccaactgagtcacaaaactttgacgatgtacaaacgccagtaattgacggt
tactttgcaagtgaaggtgttgttgctggtggcgcggttgattacaacgatgcaagtcgt
gaagaaactgtcacgtacacaaagctgggttcttggattccgcacgtacctgatctgcca
gaagatgagcaattgaagacgcgtgtctatccaaatgatccaaacgatgcttcaaaggtt
tggacgcgcgatgatccaaactacgttgaagtaccagtgccatatatcccaggatatacg
ccaacgaccgacggtagcagcacgcctttggaacaaatcgatccaaacgatgtgacgaag
ggatactacccaccggacgtgccagacaacccggcagcggatacgccaatttactatgtg
gcgcatccacaaacattggtggtttacgttgatatttcatcaggaactgaagtcgaagtt
actgagctacagcaaactttgacgggaacaacgaacgcagcttacacgaacacgttgtca
gattatgcagcacgtggttatgtcctagttaatcaagatgcaaccgcaaccgaaggaacc
tatgatgacgcagacaacgtgacccaatttgctaaggtttacttggaccacggcacggtt
atagtcacgccggataaccctggtgatccaggtaatccgatgtacccagatgtacctgga
acgccaacttggccaggtggaactgacctcgacggcgttaagcagacgattaatggtgtc
atcaattatcagtatgaaaacggggatgaagcattcccagatgtcacgcgtacggtaacg
tttgagcgttcaattacgttggacgcggtgactggtgaacaaatttcaacgacggactgg
gttgtaacggctggtgatgatgattggccggagacaccaagtccggtgaaggaaggttac
tatgctgatatctcagatattttggcggtaacgattgcaccaggtgatttcgaccgtagt
tatatggtgacgtactacccaatgggacagtatgtaccagtattcccagaaggtactgaa
aatgtgccaagtgacccaattacgtatccaaatgacccagataatccgggtgatcctttg
gagccaggagaaggaacgcctgctacgccgggtgattcagataatccaaccttgccatac
gttcctggtttcacaccggaaggaccagatggtacgccgttggagccggttgatccaaac
aacccaagtgcgggttactggccaccagcaacgccaacggataatccgggtggtgacacg
acaattacctacacagctaatgaacaaaaggcgaccgtaacatttatcgacgatacgaca
ggcgacacactgaaggttgtcgatttgacgggtaagtctgatgaaactgatgcttaccgc
acagcgaccgacattgcgacgtacgaacgtgccggatatgtccttgtgagtgatgattat
ccaacggatggtgtagtttatgaccgtgttgatgatgaagaccaaccattcacagtgcac
ttgaagcaagccactgtcacggttgacccaagcagtccaaaggaaccaggcacggatatc
tttacgccaggtgatccggttgatcccgataacccaagtgggccaacgtggccagcaacg
ccaacgtacccaagtggtgtcactaaggatgatttgaaccagacagtcacgcgtacgatt
acctatacgtatgcaagtaatggtgaaaaggcatctgaaacggttactgaaacgttgacg
tacagtcgtacggcgaccgttaatgcggtgactggggcggtgacctatggtgcttggcag
acaactgattcaacacttgataaggttgattcgccgttgatttctggctatgtggctagt
caattaacagtcgctgaagaggcggatgttgatgcgatggccgatgatacaacggttgca
atcacgtataccaagcttggtcaatgggtgccatcattcccaccatcagctgctgatgag
gatgtgccagatgatccaattgattatccaaataacccaagtgatccaaccgaaccgttg
gagcctggtgtgaataatccaaatgatccaggtacgccggctaacccaacgttgccatat
gtgccaggttatacaccagaaggcccagatggtacgccgttgacaccggttgatccagat
aatccgagtgcgggttactggccaccagagacgccgacggataagcccggggatgacacg
gttattcactacgttgcgaatgatcaagccgctcgaatcacgtttattgatgatgatact
aagcttgagctagcagtcgacacaatttcaggtgagtcgagtgacacatcgacgtataca
acggctgatcgtatcaaggcttatgaagcgcaaggatacacgttggtgtcagatgacttc
ccagcggacttccagttcgaccgtgacgatgctacggaacaaaaatttgaggtgcatttg
aagcgcacggttttggtgattacaccagatgacccacgcacaccaagtgatccaatcttt
acgccgggtgagccggtggacccaagtgatccatcaagcccaacgtatccagctgaacca
ggtacaccaggtgagccaattgatccggcgaacccaagtggcccaacttggccggagaca
ccaacatacccagcaggattgacggccgaagatttgaaccaaacggttaacttgacggtt
aactatgtttacgaagatggtacgacgggtgctcatgacccacacacggatgcggtgcac
tttacgcgtacggcaacgttggacacagtgacgggtgaggtgacgtactcagattgggta
gcggttaacgatgatgatttgttagatacctacaagtcaccagtcattgacggctactat
gctgataaggcatacagtacagcggtgacggttgcggccgaagacggtgatgtgactgag
accgtgacgtacaagaagttgggacaatgggtaccatcattcccagctacgacgccaagt
gcaccgacggatccaattgattatccaaataatccaagtgatccaacggtaccaacggat
ccagctgagaatccaagtgaaccaggtacgccagagaacccaacgttaccttacgtgcca
ggttacacgccggaaggaccagatggtgagccgttaacaccggctgatccaagcaaccct
tcttcaggctacttgccaccaaacccaactaatccgggtgaggatacggtgattacctac
gtgccagctgatcaagttggttcggtaacgtatgttgacgcgacaactggtacgacgtta
tcagtcgatccattggctggtaagtcggatgaaccgggcacatatgcaaccgctgatcgt
attaagcaatatgaggcgatgggatatgtactggtaacggatggctatccaactgacttt
acgttcgatagtgacacagccaagtcacaagatttcacggtaacgttgaagcaagtcaca
gtggttgtgacgcctgatgatccaaagaatccaagtgacccaatctttacgccgggcgat
ccggtggacccaagtgatccatcaagcccaacgtatcctgaggaaccaggtacgccaggt
gacccaattgatccaaacaacccaagcggaccaacgtggccagcaacgccaacgtatcca
tctggggtaacggcgcaagatttgaacaagacggtcacacgtacaattacgtatgtttac
gaaaacggttctgaagctgcgacaaccgtgacggacaatgtcgtcttcgaacgtaccgct
acggttaatgccgtgacgggtgaggtcacatatggtgagtggacggccgtcggcgatgat
gtcgattggcaacaggttgattcaccaatgattgtcggctacatggcagacaaggcatcg
gttgaatttgtagatgttaccggtgcaactgagtcaacatcagtggttgtaacgtataca
gcggttggtcagtgggtaccacatttcccaccgggaactgaagatgtcccaagtgaccca
atcaactatccaaacaacccagatgatccaacgaatccagcggatcctggtccggataat
ccggccgaccctggaacgacggataatccaaccttgccatacgtgcctggctttacgcca
caaggaccggatggtgagccgttggagccggttaacccaagcaacccaagtgagggatac
tggccaccagttattccggatgatcctaagcagagccaagatattacctatacggctaat
gaacaaactgcgcgaatcgtcttcattgatgatacaaccggcacgacattggcaactgat
gatatcgatggtgtctcggatgagaagtcgacgtatacgacggcggaccgtttggctgct
tactacgcccaaggttacacgttggtcagtgatggctatccagccgactttgcgtttgac
cgtgtcgatggcaatgttgaaacgttcgaggttcacttgaagcacgctgcgattacagtg
acgccagatgatccaaagaacccatcaacgccaatttacacaccaggtgacccagtcgat
ccaagtgacccatcgagtccaacatatccagcggaaccaggtacgcctggtgatccaatt
gatccggataatccaagcggaccaacttggccagcggtaccaacgtacccagctggggtg
acgacgacagacttgaacgagacagttaaccgcacgattacgtacgttgatgaggcaggt
aatacggtcttcgatgctgcaacggataaggttagcttcacacgcacggcgacagttgat
gcggtgacgggtgaagtcacttacggtgcgtgggttgcaactggtaatgacacaacgttt
gacgcggtgagctcaccagttaagactggctactacgctgataaggaagtggtagctgaa
accactggcttgacggcaacgacgggggatgaaaccgtccaagttgtctacaagccaatg
ggacaatgggtaccatcgttcccagccggaacggaaaacgtaccatctgatccaacgacg
tatccaaacgacccagctcatgccgatacgccactcgaaccaggtgattcaaatacgaat
gtgccaggaacgccagataatccaaccatgccatatgtaccaggctttacgccacaaggt
ccagacggcacgccacttgaaccagtaacgccaggttcaccagaaggtggttattggcca
ccagcaacaccaaccgataacccaggtggtgatacggttgtgacttatgttgcggatgaa
caaaaggcaacgattacgtaccacgacgtgacgactgatactgatttgtcggttgatacg
attgatggtcattccgatgaaacaagttcatacaccacagcacaacgcattgcgatgtat
gagcaacaaggttaccgtttggtcaatgatggatatccaggtacggacttcacgttcgat
cgtgatacggcaactgatcaagcgtttatcgtacaacttgagcgtattacgcaaacgatt
acgccagatgatccaaagacgccaagttcaccgatctttacgccgggcgatccggtggac
ccaagtgatccatcaagcccaacgtatcctgaacaacctggtacgccaggtgaaccaatt
gatccagataatccaagtggcccaacttggccagcgacgccgacttatccagccggtttg
gagcatgatgatttgaatcaaacggtcacgcgtgaagtaacttatgtttacgatcgtgat
ggttcagaagctgcgacgacggcgacggaaacgttgacgtttacccgtacggctaccctt
gatacggtcagtggcgacatcacatatggtgactggattgcggctgatagtgataccacc
tttgatgaggtgacgtcaccaacaatcgctggttatacggctaaccgtgcgtcagttgca
gaagcgaccggcgttgcggcaacagatgcagatacgtcaattgaagtgcgttacgttgcg
aacgaacaacatgcaacgattacgtatattgatgacaacacgcaacaaacgattgtcatg
gatgacattaccggacaatcggatggcacgacgacttacacgacagctgaccggattgcg
gctttgcaggcgcaaggttacagcctcgtgagtgatggttggccagctgacttcgtgttc
gacacggatgatgatacgacgcaagccttcgaggttcacttgaagcacgcgacaattacg
attgacccagatgatccgaagacgccaagttcaccggtttacacgccaggtgacccggtt
gatccggatgacccagatggaccaacgtatccagctgaacctggtacgccaggcgagcca
attgatccaaacaatccaagtggcccaacttggccagcgacaccaacttatccggatggt
ttgaagacgactgatttgaatgagtcagttgatcgtacgattacgtatgtttacgagaat
ggtaacgaagctgctgagacggtgacggataacgtccagttcacacgcaccgccgagtat
gacgtggtgacgggcactgtgacatatggtgagtgggttgcgacgaacggtgataccacg
tttgatgcggttgaatcaccagtgattaccggctactatgctgatttgacgcaagttgat
gaaactgctaatttgacggctgatagtggggatgaaaacgttaaggtgacatataagcaa
atgggacaatgggtaccatcgttcccagctaatacaccaagtgtgccaacggatccaatc
acgtatccaaacgatccggatgatccaacgcaaccacttgaaccgggtgcgccagattat
ccagtggtgccatacgtgccaggctttacgccagaaggaccggatggcccattgcaacca
gttgatccgactgatccaagcaagggttatgtgccaccggcaacaccgacggacaacccc
ggtgaagacacgacgattaattacgttgccaatgagcaaacggccacgattacgtttatc
gatgacacgacgaagacgaacttggcagtcgatacaatcacaggtgtttctgatgcaacg
tcaacgtatactacggctgagcgcattcaagcgtacttggcgcaaggttacacgctcgtt
tctgatggttatccaactgacttcacgtttgaccgtgatgacagtaagacgcaagcgtat
gaagtgcacttgaagcacgcgacgattacgattacgccaagtgatccgaagacgccaagt
cagccaatttacaacccaggtgatccggtcgatcctagtgacccagatagcccaacgtat
cctgaacaacctggtacgccaggtgaaccaattgatccggataacccaagtggtccaact
tggccagcaacgccaacgtacccagctggtttgactgaaactgatttgaatgaatcagtc
acacagaccatcacgtatgtttacgccgacggccaagaggcaagtgatccaaaggctgac
acggtaacgtttagtcgtacggcaacccttgatccggtcacaggtgcggtaacatatggc
gagtggattgcagcaaatagtgataccacgtttgatgcggttgcctcaccagtgattact
ggctatgttgcggacaagcaaacggtcgctgaggtgacgggtattcaggcaactgatgct
gacactgacccagttgtgacttatacggcgatgggacaatgggtaccatcatatccagct
ggtacgcctgatgtaccaacggatccgattacgtatccaaatgacccagatgaccctacg
caacctgctgatccaacggcaccaaattatccggttattccggatgtacctggcttcacg
ccacaaggaccagatggcccattgcaaccagtcgatccaagtgacccaagtaagggttac
gtgccaccagcaacgccgactgatccgacacaagatacgacgattacgtatgttgccaac
gagcagcaagcgacgattacgtatcttgatcagacgactggcaagcaattggcaatggat
acaatcacgggacactctgatgagacgtcaacgtacacaactgctgacaagattgcggcc
tacgaggcagcgggatatgtcttggttacagatggttatccaggtgtcaactttaccttc
gatcgtgaagatgattatgaccaaacgtacgaagtgattttcattcacgctgtgattaca
gttgatccaaatgatccaaagacgccaagttcaccaatcttcacgccaggtggtccggtt
gatccggacgacccaacgagcccaacttatccagttaaccctggtgacacaccaacgcca
acgtacccaggtggtttgactgaaactgatttgaacgaatcggtaacacaaaccatcacg
tacaagtacgcggacggttcaacggcagctgatgatgcaactgataccgtcacgttcagt
cgtacagccaaggttgatgcggtaacgggaacagttacttacggtgattgggtcgctgcc
aatgaggacacaacctttgatgcagtggactcaccagtgattacaggttatgtggcggat
aagcagacagttgctacggtgacgggtatcggtgccaaggatgcggacacgacggttaat
gttgtgtacaacaagatgggacaatgggtaccatcattcccagccgatacgacaaatgtt
ccgagtgacccaatgacgtatccaaataacccagatgatccaacggaaccactcacacca
ggaccagaaaatgaaacagatccaggtgacccagacaatccaacgttgccatatgtacca
ggcttcacgccgcaaggaccagatggcgagccattggacccagttgatccaagtaaccca
agttcaggttactggccaccaactttgccaagtgacccaaccactgatacgacaatcgag
tacaaggcggatgaacaagaagccacgattacgtatattgatgaggtgacgggcgatacc
ttggttgtcgacacaattaagggtggttcggatgaatcaagtacgtacacgacggctgac
cgtttggctgattacttggctaatggttatgcgttggtcgcagacgaatatccaactgac
tttacgtttgaccgtgatacgacggtcacgcaagcctacaaggtaaccttgacccacggt
tcacaaacgattgatccaaatgatccaaagacgccaggaacgccaattaatccggataac
ccagatggaccaaagtatccagatggtttgaagtcaactgatttgaatgagtcagtgacg
cgtacgattacgtatgtggatcaagccggcaagacgatggcgacggcggttgaggaaacc
attcactttacgcgtacggcaacccttgatacggtaaccggatcatacacgtacagtgct
tgggtgccaacgacggtaacgtcaatggatgcagttgattcaccagtaattgctggttac
gtggctgatcgtcaaacggtcgctgctttgcctgatttgacggcaacgtcagcggacgtg
tcagagaaggtcgtttactcaccaattggtcagtacgtaccatcattcccaagtggcgta
acggatgtgccaagcacgccaattgattatccaaataaccctgacgatccaactacaacg
gatacgccaggtgaggataatccagccacaccgggaacacctgataatccaacgatgcca
tatgtaccaggcttcacgccacaaggtccagatggcgagccgttggatccagttgaccca
gataacccaagttcaggttactggccaccagcgccaagtgagacaccgactgaagacaca
acgattacgtacacggccaataagcaaacggccacgattacgtacatcaatgatgagaca
ggtagcgttttggcagttgatacgattactggtggttcagctgaaaccagcacgtacacc
gcttataaccgcatcatggtctacaagttggctggtatgatgttggtaagcaatggttac
ccaagtcactttacgtttgatcgtgacgaaacggttgatcaagcctttgaagttcacttc
aagggtgcgacaatcacggttacgccagatgatccaaaggtgccgggtgatccgatttac
caaccaggtgatttgattgatcctaacgatcccgattcaccaaccttcccagacccactt
ggtgagccaggtacgccggttgatccggatgacccagattcaccaacttggccacaacca
ccggtttggccagatggggtaacggcggaagatttgcgtgaagaggtcaaccagaccatc
acatatatctatgagaaggatggatcaacagctgctaagacagttaccgatcaggttgtc
tttacccgtacgattacaattaacgtcatcgctgcccaagagagtgcacaaccacgagca
cgtttggcacgtgccgcaacgtcaagtgcgattgtttactctgattggcaggcagtgaac
ggtgatgatacctttgatgccaagacatcgccagttattccgggctacatcgctgaccgt
ttggtggttgatgaagtggcaggcatggatgaaacgagtgaagatgacatccaacaagtt
gtttaccgtcaacttggttcttgggtacctagtgtgccacaagtgccaggcgttaagaca
ccaggcgaagtgacgtatccaaatgatccagatgacccaacgaagacggctgatccaaat
tcaccaggttatccggtcatcccatatgtacctggctttacgccacaaggtccagatggt
acgccactgcaaccagttgatccgaagaacccaagcaaggtttacttgccaccagctgtg
ccaagtgatccaacggcggatacaaccattgtttacacggttgatcgtcaacacgccaag
gttaacttcattgatcaaaacacgaagcaagtgctccatgttgagcagttgtctggcgat
agttacagcaagtcgtcatacacgaccgctgagcaaatcgcttactacgtggcccaaggt
tacgttcttgttcgtgatggttatcctgctggtggtatgacattcgatgctgattcaacg
ttgaaccaaacatttgctgtcacgttggcgcacggtacaaagacggttgatccaaataac
ccaggggtaccaggtacgccaattgatccaaacaacccagatggtccaaagtggccagct
ggtgttgacgaagatcacttgaagacgtcaacgacgcgtacgattatcttccgcacaagt
gacggtacgattgtcgatacgaagacgcaaattgtgacgtacacgcgtacggcaactgtt
gatacagttactggggaggtcacgtacggtccttggacggcggaagatggctcacatgtg
ccagatgctgctgtaccaggcatgccaggttacgtggctgatcgcgaccttgtaccaggg
gtggatattccagttggtacacctaacttcactgagtatgtgacgtacacggttgtgcct
gagcaaacgacggcggaagtggggccaaatgagccggtgattgtacctgaggtattgacg
ccacattcattggcctacacggcagttcaatcagcaacggcgacaactgaaagtgcagct
tcgttggcttacacagctgaacaaagcgctgctgagtcggcaacggcccagcattcaggc
gtcttgccatacactggttcggacgagcaagagggtgctaaggcaactggtttggctatg
ttgttcggtttgttcctcggtttgttcaagcgtcgtaagcgcaaggatgaagctgaagaa
acaagcaagaagcacgacgataagtaa

DBGET integrated database retrieval system