KEGG   Waddlia chondrophila: wcw_1621Help
Entry
wcw_1621          CDS       T01255                                 

Gene name
pkn5
Definition
(GenBank) putative serine/threonine protein kinase
Organism
wch  Waddlia chondrophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SpoIIE APH Kdo Kinase-like Haspin_kinase Pkinase_fungal Seadorna_VP7 RIO1 Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ADI38966
UniProt: D6YSC1
LinkDB All DBs
Position
1707123..1708697
Genome map
AA seq 524 aa AA seqDB search
MSGEKKLTEQSATANQLPLPKKIGPYRIEGLLSKGGMSDLYLGIHPTSKNPIAVKVLSQK
FITNTEVVQRFLNEAEIISMTNHPNIVKMHGHGEWEGGLFIAMEYIEGASLREYLLSTPL
SLKRALGIIIDIAYALCHLHTHGVIHRDLKPENILVTESGAIKVIDFGIAQLLTEKVSPE
QNLAPRLIGTPIYISPEQKKNPETVSFPSDIYSLGIISYELILGKLSQGHLHLSLMPTGM
QGILQKCLLPNPDERYQDIVDFITDVSSYLNSPSLQKERMTGDQLSELQEDLKNIQSLLV
NNIPSEWENVNIGLSSHKTMMTPGIYHHFFSIDEFQYAIILGEISCVGAESYMKTAIFKG
ILLALLSNYKEPGEFCYTLNRLLVEHQIGPILNFTFLILNIKNHTLTYTSCGTGHLWMIQ
DERLTLLPSNEDPQALGIDQNTVFNSRVRPWKPGEILFVSMIPKLLKKPPQALFQELLKE
YSPSPPQQFVDHLIRNLRLSLGEQIKSRPISLLAIEHIQKPNSV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtgagaaaaagcttactgaacagtctgcgactgctaatcaacttcccttgccc
aaaaaaatcggaccctaccgaatcgagggtttgttaagcaaaggaggaatgagcgacctc
tatttaggcattcatccgacatcaaaaaatcccattgcggtcaaagttctttcgcaaaaa
ttcattacaaatacagaggttgtgcaacgtttcctaaacgaagcggaaatcatttcgatg
actaatcatccgaatatcgtaaaaatgcacggccatggagaatgggaggggggccttttc
attgcgatggaatatattgagggagcctcccttcgagaatatcttctaagcactcccctt
tctttaaaaagagctctggggatcatcatcgacattgcttacgcgctgtgccatctgcat
actcacggcgtgatccatcgggatcttaaaccggaaaatattttggtcacagaatcgggc
gccatcaaggtcatcgatttcggcattgcccagctattgacagagaaagtcagccctgaa
caaaatcttgcacccaggctcatagggactcctatctatatcagccctgaacaaaaaaaa
aatccggaaacagtttcttttccctccgatatctattccttagggatcatctcttatgaa
ctcattttaggaaaactcagccaagggcatttacatctctctttgatgcctacaggcatg
caaggaatcctgcaaaaatgcctgcttcccaatcccgatgagagatatcaggacattgtc
gattttatcaccgatgtttcttcctatctcaactccccctctcttcaaaaagaacggatg
actggcgaccagcttagtgaattacaggaagatctgaaaaatattcagagtctgctagtc
aacaacatcccttccgaatgggaaaatgtcaatatcggactctcttcgcataaaaccatg
atgactccaggaatctaccaccattttttttcgattgacgagtttcaatatgccatcatt
cttggagaaatttcctgcgtcggagcggaaagttacatgaaaacagcgatatttaaggga
atcctcttagctttactctcaaactacaaagagccaggagaattttgctacacacttaac
cgcttgcttgttgagcatcagatcggccccatcctcaacttcacttttctcattctcaat
atcaagaaccatacattgacctatacatcatgcggcaccggtcacctctggatgatacag
gatgagagattaactctccttcccagcaatgaagatccgcaagctttaggaatcgaccaa
aatactgtttttaattctcgagtacgtccttggaagccaggagagatcctattcgtctca
atgattccaaagctgttgaagaaaccccctcaagccttattccaggaactcctcaaggaa
tattccccctcgcctccccaacagttcgtcgaccatttgatcagaaacttacgcctttca
ttaggcgaacagatcaaaagccggcccatttcccttctcgcgattgaacatattcaaaaa
ccgaattcagtataa

DBGET integrated database retrieval system