KEGG   Weissella ceti WS105: WS105_0244Help
Entry
WS105_0244        CDS       T03295                                 

Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
wci  Weissella ceti WS105
Brite
KEGG Orthology (KO) [BR:wci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:wci03110]
    WS105_0244
Chaperones and folding catalysts [BR:wci03110]
 Heat shock proteins
  HSP33
   WS105_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIM63834
UniProt: A0A075TY83
LinkDB All DBs
Position
289322..290212
Genome map
AA seq 296 aa AA seqDB search
MTDKLVRAVTHDGAFRAIALDATEMVQVTSKYHAASTLGLVVLGRALIGGLLLSNALLKG
DERLVMTINGGGPIGKVVVETSAEGHVRGYVENPTLELPLKADGQVDVAGAVGTNGFLTV
TKDMGEGMAPFNGQVELATGEIGDDIAYYLAKSEQIPSAVALTVDVSDAGVEVAGGFMVS
ALPDATEADIMGLETKLQNLPAMNDVLGANHEPFDALTALFGDDAVKLLEEMPVVPYPEN
TKMDYTKMLATLPVEQLTDMLENDHGLEVVDRFTGNRIQFSEAELAAIIAQVNAAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacagataagttagtacgtgcagtaacacatgatggcgcatttcgtgccattgcatta
gacgcaactgaaatggtacaagtaacaagcaagtaccatgccgcatcaacactaggattg
gttgtgttgggacgtgcattaattggtggtttattactatctaatgcattactaaagggt
gatgaacgtttagtaatgacaattaatggtggtgggcctattgggaaggttgttgtagaa
acgtcagccgaaggacatgttcgtggatatgttgaaaacccaacactagaactaccatta
aaggcagatggtcaagtagacgtcgctggagcagttggaacaaacggatttttgactgta
acaaaggatatgggcgaaggtatggcaccatttaatggccaagtagaattggccactggt
gaaatcggagatgacattgcttactacctagcaaagtcagaacaaatcccatctgcagtt
gcgttaacagtggacgtttcagatgctggtgttgaagttgctggtggatttatggtctct
gccttacctgatgcaaccgaagcagatatcatggggctagaaacaaagctacaaaactta
ccagcgatgaatgacgtacttggtgctaaccatgaaccgtttgatgcattaacagcgttg
tttggggatgatgcggttaagttgttggaagaaatgccagttgttccatatcctgaaaac
acaaagatggactacacaaagatgttggcaacattgcctgtcgaacaattaacagatatg
ttggaaaatgaccacggtttggaagtggtggaccgattcacgggtaatcgtattcaattt
agcgaagccgaattagccgcaattattgcacaagtgaacgctgcgcaataa

DBGET integrated database retrieval system