KEGG   Weissella ceti WS105: WS105_0321Help
Entry
WS105_0321        CDS       T03295                                 

Definition
(GenBank) PrkC protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
wci  Weissella ceti WS105
Brite
KEGG Orthology (KO) [BR:wci00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:wci01001]
    WS105_0321
Enzymes [BR:wci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     WS105_0321
Protein kinases [BR:wci01001]
 Serine/threonine kinases: Other
  Bacterial family
   WS105_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Haspin_kinase APH RIO1 CwsA FTA2 Kdo DNA_pol_A_exoN Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AIM63911
UniProt: A0A075U549
LinkDB All DBs
Position
374442..376166
Genome map
AA seq 574 aa AA seqDB search
MLTGHLIGDRYRMISRLGKGGMANVYRAFDTILEREVAVKFMRLDLKDDPMVQKRFQNEI
QASSDLVNPHITQVYDYGEENGSQYLVTEFVDGKDLKRYELTESPIPLTKIVDLMSQILL
GVEAAHEQHIIHRDLKPQNILISLDGEAKITDFGIARAQSSYGMTQTNTAIGSVHYMAPE
QVRGETASVRSDIYSLGIMLFELLTGDVPYTGETSVAVAVKHTTETMPSVREQDPRIPQA
LENVVLKATAKHPADRYASAEEMREDLETVLSPDRVNEAKWVESRVSEDSTVTKVLNLSG
ADRHGQATQMTTTIATQVVPDRDEITVAPIGDVKKRQPKKTSRKRWLIALIGVLLVSIVA
AAFMIKAQPQTYTVPDVKTMNLSQAKAALAASNLALGDVKEEYSSTLAKDMIIASTPGSG
TKVRKDAKVDLVISKGPEKVRFGDYVNAKYADVSDELKRKGYLINHDYQYSNYYPAGYII
SQSVKADAKVIPGDTNVTFVVSNGPLPVTPTLPSTRPETNSGASESKDEPSSETSSSAEE
SKSEDKDSAKDDKNTDDTKDVESEKETTPKDDKD
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgttaactggacacttaattggtgatcgttatcgtatgatttctcgtttaggaaaaggt
ggaatggcgaatgtctatcgtgcctttgacaccatcctagagcgtgaagttgcggttaaa
tttatgcgcttggacttgaaagatgatccgatggttcaaaagcgttttcaaaatgaaatt
caagcatcatctgacttagtaaatccacatattacgcaagtttatgactacggtgaagaa
aatggtagccaatacttggtcactgaatttgtggatggtaaagatttaaagcgatatgaa
ctaacagaaagcccaatcccattaacgaagattgttgacttgatgtcacaaattttgttg
ggggttgaagccgcgcatgaacaacacattattcatcgtgacttgaagccgcagaatatt
ttgatttcacttgatggtgaagctaaaattactgactttggaattgctcgtgcgcagtct
agctacggtatgacgcaaacaaatacggccattgggtcggtgcactacatggcaccggaa
caagtccgtggtgaaacggctagtgttcgtagtgacatttattcactaggaattatgtta
tttgaacttctaacgggtgatgtgccttacacaggcgaaacatcagttgcggtcgctgtg
aagcacacgactgaaacgatgccttcagttcgtgagcaagatccacgtatcccacaagct
ttagaaaatgttgtgttaaaagccactgctaagcatccagctgatcgttatgccagcgct
gaagagatgcgcgaagacttggagacggtgttgtcacctgatcgtgttaatgaagcaaag
tgggttgaatcacgtgtaagcgaagattcaacggttacaaaggtgttgaatttgtcaggc
gctgatcgtcatggtcaagccacacaaatgacaacaacgattgcgacgcaagtagtacct
gatcgtgatgagataacggttgcacctattggtgatgtgaagaaacgtcaaccaaaaaag
acatcaagaaagcgttggttgattgctttgattggtgttttgttggtatcaattgtggcc
gctgcctttatgattaaagcgcaaccgcaaacctatacggtacctgatgttaagacgatg
aacttgtcacaagctaaggcggccttggcagctagtaatttagcgttgggggatgtcaaa
gaagaatattcatcaacgttagctaaggatatgatcattgcgtcaacaccaggatctggc
acgaaagttcgtaaagatgccaaggttgatttggttatttctaaaggtcctgaaaaagtg
cgctttggtgactatgtgaatgcgaagtacgcggatgtttccgacgaattaaagcgtaaa
ggttatttgattaatcacgattatcaatatagcaattactatcctgcgggttacattatt
agtcaaagcgtgaaggctgatgctaaggttattcctggtgatacaaatgtcacttttgtc
gtatcaaatggacctttgccagttacaccaacattgccatcgactcgaccagagacaaat
agtggggcaagcgaaagcaaagatgagccgtcgtccgaaacgtcttcatcagcagaagaa
tctaagtcagaagacaaagactctgccaaagatgacaaaaacactgacgatacaaaagat
gtagaatcagaaaaagaaacaacacctaaagacgataaagactaa

DBGET integrated database retrieval system