KEGG   Weissella ceti WS105: WS105_0986Help
Entry
WS105_0986        CDS       T03295                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wci  Weissella ceti WS105
Pathway
wci00473  D-Alanine metabolism
wci00550  Peptidoglycan biosynthesis
wci01100  Metabolic pathways
wci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WS105_0986
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WS105_0986
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    WS105_0986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wci01011]
    WS105_0986
Enzymes [BR:wci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WS105_0986
Peptidoglycan biosynthesis and degradation proteins [BR:wci01011]
 Precursor biosynthesis
  Amino acid ligase
   WS105_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIM64576
UniProt: A0A075U105
LinkDB All DBs
Position
complement(1048478..1049635)
Genome map
AA seq 385 aa AA seqDB search
MTEKLNIALFFGGNSSEHDVSKRSAWNIYQAMDKDKYNVTVFLISKAGIIMNPEDSLRVF
EGEDEDPIVAAAMEKMDMTNPLAPIANLGAMDQIDLFYPVVHGNLGEDGTLQSLFRLLQK
PFIGPGTAASAMAFDKDLTKRVLNQAGIRNTKYVLLTDQTKDDYTYEELVEKLGTSTLFV
KAAKQGSSVGIHRVKNAEEYAAGLADALQYDYKVLVEAGLKSPREVFISILGNENPRASR
IGGIILPDAGEDVWYDYNNKFVDASGMTFELPATLDADLEAEITEMALATYKALGLVGLT
RMDFMVDQDGVPYLGEPNTLPGFTNISLYPQMWEVSGISYSALIDEIIAYGLAEFERNAE
LSYDFVALGEEKVGTKNINAERATD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaagttgaatattgcattgttctttggtgggaactcatcagaacacgacgta
tcaaagcgttcagcttggaatatttatcaagcaatggataaggacaagtacaatgtgact
gtctttttgatttcaaaggcaggaatcattatgaacccagaagactctttgcgtgtcttt
gaaggtgaagatgaagatccaatcgttgcagctgcaatggaaaagatggatatgacaaac
ccattggcaccaattgccaacttgggcgcaatggatcaaatcgatctattctacccagtt
gtccacggtaacttgggtgaagatggaacattgcaatcattgttccgtctattgcaaaag
ccattcattggtccaggaactgcggcgtcagccatggcctttgacaaggatttgacaaag
cgtgtgttgaaccaagctggtattcgtaacacaaagtacgtgttgcttacagaccaaact
aaggatgactacacatacgaagaacttgttgaaaagctaggaacaagcacattgtttgtg
aaggctgctaagcaaggttcatctgttggtattcaccgtgttaagaatgcagaagaatac
gctgcaggattggccgatgccctacaatacgactacaaggtacttgttgaagccggattg
aagtcaccacgtgaagtgtttatctcaatcttgggtaatgaaaacccacgtgcatcacgt
atcggaggaattatcctacctgatgctggtgaagacgtttggtacgactacaacaacaag
ttcgtggacgcttcaggaatgacatttgaattgccagcaactttggatgctgacttggaa
gctgaaattactgaaatggcccttgcaacttacaaggcgcttggtcttgttggtttgaca
cgtatggacttcatggttgatcaagatggtgtgccatacttgggagaaccaaacacattg
cctggatttacaaacatttctttgtatccacaaatgtgggaagtttcaggaatcagctac
tcagcattgattgatgaaatcattgcttacggattggctgaattcgaacgtaacgctgag
ttgtcatacgacttcgttgctcttggtgaagaaaaggtcggaactaagaacattaacgct
gaacgtgccactgattaa

DBGET integrated database retrieval system