KEGG   Wolbachia wCle (Cimex lectularius): WCLE_010330Help
Entry
WCLE_010330       CDS       T03628                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
wcl  Wolbachia wCle (Cimex lectularius)
Pathway
wcl00061  Fatty acid biosynthesis
wcl00780  Biotin metabolism
wcl01100  Metabolic pathways
wcl01212  Fatty acid metabolism
Module
wcl_M00083  Fatty acid biosynthesis, elongation
wcl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:wcl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WCLE_010330 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WCLE_010330 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:wcl01004]
    WCLE_010330 (fabZ)
Enzymes [BR:wcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     WCLE_010330 (fabZ)
Lipid biosynthesis proteins [BR:wcl01004]
 Fatty acid synthase
  Component type
   WCLE_010330 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas CxC3
Motif
Other DBs
NCBI-ProteinID: BAP00319
UniProt: A0A060PZW6
LinkDB All DBs
Position
complement(1022657..1023097)
Genome map
AA seq 146 aa AA seqDB search
MQFNISDIIKILPHSYPFLLVDRVIECDPGRSIKAIKNVTFNEPFFIGHFPGHPIMPGVL
IIESLAQASAICVLGKESQSTMENKVVYFMSIENAKFRKPVTPGDTLILQSNIKNARLSA
CKFECVAYVDEERVAEATILAMLQNK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaatatcagtgatattataaaaatattaccacactcttatccgtttctctta
gtggatagagtaatagaatgtgatccaggtaggagtataaaggcaatcaaaaatgtgact
ttcaatgaaccgttttttattggccattttcccggccatccaataatgccaggagtttta
ataattgaatctctagctcaggcatctgcaatatgtgttcttggtaaagaaagtcaaagt
acaatggaaaataaagttgtttactttatgtccattgaaaatgcaaaattcagaaagcca
gttactccaggagacaccctgattcttcaatctaacattaaaaatgcacgtttgagtgca
tgcaagtttgagtgtgttgcatatgtagacgaagagagggttgcagaagcaacaatttta
gccatgttgcaaaacaagtaa

DBGET integrated database retrieval system