KEGG   Weissella ceti WS74: WS74_0360Help
Entry
WS74_0360         CDS       T03280                                 

Definition
(GenBank) hypothetical protein
Organism
wct  Weissella ceti WS74
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bact_lectin DUF3048_C Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: AIM62612
UniProt: A0A088GK26
LinkDB All DBs
Position
410972..415795
Genome map
AA seq 1607 aa AA seqDB search
MGFKMYKAGKFWVFSAAVLTVVGAAGVMDANSQIYANSEATQGGQLAATSKELIVNKDNF
EEHFNINGAATYDKDTGIATLTPFQQRVSGNISMKHKFDATQDFSISGEINLGANKNGSG
ISGSGTNRGGDGIGILFHPGDPKVVGGKGGAIGIGGVPNGFGFKFDTYWNRNDSNAADAW
AVKDPKTNAAGESLELKSFGAFVKNRADNAAETVVEAGTADPKLIGEPDGNTFKPMELKY
TAATKTLTVTYEGKTWSRSIADWITQDELSFAISASTGPALNLQQFRMNELRMTQNVPET
PTRPVDEKGNPIEVPADKTMPIVDGFPGDEVEIDIKDIPDIPGYDKPVADENGKVKVKVP
EAGKMIDLPYTEKSTPTRPVDEKGNPIEVPAGETMPEVKGEPGDEVELNVDDLPNIPGYE
KPKGDENGKVKVKIVDDGKGGKVYDVTYTEKSTPTRPVDEKGNPIDVPKDTKMPDVKGEP
GDEVELDVNELPDIPGYAKPEADENGKVKVKIKDDGKGGKVYDVPYTQATPTRPVDEKGN
PIDVPKDAKMPEVKGEPGDEVELDVNDLPDIPGYEKPKGDENGKVKVKIVDDGKGGKVYD
VTYAEKTTPTRPVDEKGNPIDVPKDTKMPEVKGEPGDEVELDVNDLPDIPGYAKPEADEN
GKVKVKIKDDGKGGKVYDVPYTQATPTRPVDEKGNPIDVPKDAKMPEVKGEPGDEVELDV
NDLPDIPGYEKPKGDENGKVKVKIVDDGKGGKVYDVTYTDKKTPSRPIDEKTGEEIKLPE
GKTMPELDGKPGEEVEIDVNDLPDIPGYDKPKGDKNGKIKVQIPEDGKPADVPYTPAEDK
KTPSRPVDEKTGEEIKLPEGKTMPELDGKPGEEVEIDVNDLPDIPGYDKPKGDENGKIKV
QIPEDGKPADVPYTPAEDKKTPSRPIDEKTGEEIKLPEGKTMPELDGKPGEEVEIDVNDL
PDIPGYDKPKGDENGKIKVKVPEDGKPADVPYTPAEDKKTPSRPVDEKTGEEIKLPEGKT
MPELDGKPGEEVEIDVNDLPDIPGYDKPKGDENGKIKVKVPEDGKPADVPYTPAEDKKTP
SRPVDEKTGEEIKLPEGKTMPELDGKPGEEVEIDVNDLPDIPGYDKPKGDKNGKIKVQIP
EDGKSVDVPYTPAEDKKTPSRPVDEKTGEEIKLPEGKTMPELDGKPGEEVEIDVNDLPDI
PGYDKPKGDKNGKIKVQIPEDGKPADVPYTPAEDKKTPSRPVDEKTGEEIKLPEGKTMPE
LDGKPGEEVEIDVNDLPDIPGYDKPKGDKNGKIKVQIPEDGKSVDVPYTPKKNTTPSRPV
DKNTGKEIKTDKSFPILEGKPGEEVEIDVNDLPEIPGYDKPKGDKNGKIKVQIPEDGKSV
DVPYTPKKNTAPSRPVDKNTGKEIKTDKSFPILEGKPGDVVEIDVNDLPEIPGYDKPKGD
KNGKIKVQIPEDGKSVDVPYTPKKNTTPSRPVDKNTGKEIKTDKSFPILEGKPGDVVEID
VNDLPDIPGYDKPKGDKNGKIKVTIPENGMIDFGYTPIEAGKPGQSQQNNNGSKNTPDNN
APQKGKSKGDAAYPNTGSETNALVSALGAAMLALTGLFAGLTKLRKK
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaaaatgtataaggctggtaaattttgggtatttagtgcagctgttttgact
gtcgtgggtgcggcaggtgtaatggatgcgaatagtcaaatttacgcgaattcagaagcg
acgcaaggtgggcaacttgcagcgacttcaaaagaattaattgttaataaagataatttt
gaagaacatttcaatattaacggggcagcaacgtatgataaagatacgggaattgcaacc
ctaacgccattccaacaacgtgtttctgggaatatttctatgaaacataagtttgatgca
acgcaagatttctctatttctggagaaattaatctaggagcgaataagaacgggtctgga
atcagtgggtctggaacaaatcgtggtggtgatggaatcggaattttgttccacccaggg
gatcctaaagttgttggtggaaaaggtggagctatcggaatcggtggtgtaccaaatgga
tttggatttaagtttgacacatattggaatcgaaatgattcaaacgcagctgatgcttgg
gcagtaaaagaccctaagacaaatgctgctggggagagcttagaactaaagtcttttggt
gcattcgttaagaaccgagcagataatgctgcggaaacagttgtagaagcaggaacggct
gaccctaagttaattggagaaccggatggaaacacattcaagccgatggaacttaagtat
actgctgcaacaaagactttgactgtgacttatgaaggaaagacatggtcacgatcaatc
gcagactggattacgcaagatgaattgtcatttgctatttctgcatcaacagggccagcg
ttgaacctacaacaattccgtatgaacgaattgcgtatgacacaaaatgtgccagaaaca
ccaacgcgtccggtagatgaaaagggaaatccaattgaagttccagcagataagacaatg
ccaattgttgatggattcccaggtgatgaagttgaaattgatattaaggatattcctgat
atcccaggatacgataagccggtagctgatgaaaatggtaaggtgaaagttaaagttccc
gaagcaggaaagatgattgacttaccatatactgaaaagtcaacaccaacacgtccagtg
gatgaaaagggaaacccaattgaagttccggcaggagaaacaatgccagaagtaaagggt
gaaccaggagacgaagttgaattgaatgttgatgacttgccaaacattccaggttacgaa
aagccaaagggtgacgaaaatggtaaggtaaaggtcaagattgttgatgatggtaagggt
ggaaaagtctacgatgtaacttacactgaaaagtcaacaccaacacgtcctgtagatgaa
aaaggaaacccaatcgacgtacctaaggatacgaagatgccagatgtgaagggtgaacca
ggagacgaagttgaacttgatgtaaatgagttgccagacatcccaggatacgctaagcca
gaagccgatgaaaacggtaaggtaaaggtcaaaatcaaggatgatggtaagggtggaaag
gtatatgacgtaccttatacacaagctacaccaacacgtccagtagacgaaaagggaaac
ccaatcgacgtacctaaggatgcgaagatgccagaagtaaagggtgaaccaggagacgaa
gttgagcttgatgtaaatgacttgccggatatcccgggctacgaaaagccaaagggtgac
gaaaatggtaaagtaaaggtcaagattgttgatgatggtaagggtggaaaggtctacgac
gtaacttacgctgaaaagacaacaccaacacgtccagtagatgaaaagggaaacccaatc
gacgtacctaaggatacgaagatgccagaagtaaagggtgaaccaggagacgaagttgaa
cttgatgtgaatgacttgccagacatcccaggatacgctaagccagaagccgatgaaaac
ggtaaggtaaaggtcaaaatcaaggatgatggtaagggtggaaaggtatatgacgtacct
tatacacaagctacaccaacacgtccagtagacgaaaagggaaacccaatcgacgtacct
aaggatgcgaagatgccagaagtaaagggtgaaccaggagacgaagttgagcttgatgta
aatgacttgccggatatcccaggctacgaaaagccaaagggtgacgaaaatggtaaggta
aaggtcaagattgttgatgatggtaagggtggaaaggtctacgatgtaacttacactgac
aagaagacaccatcacgtccaatcgacgaaaagactggggaagaaatcaagttgccagaa
ggtaagacaatgcctgaacttgacggaaagccaggagaagaagttgaaattgatgtgaac
gacttgccagacatcccaggatacgacaagccaaagggagacaagaacggtaagatcaag
gtgcaaattccagaagatggaaagccagctgatgtgccatacacaccagccgaagataag
aagacaccatcacgtccagtagatgaaaagactggggaagaaatcaagttgccagaaggt
aagacaatgcctgaacttgacggaaagccaggagaagaagttgaaattgatgtgaacgac
ttgccagacatcccaggttacgataagccaaagggtgacgaaaacggtaaaatcaaggtg
caaattccagaagatggaaagccagctgacgtgccatacacaccagccgaagataagaag
acaccatcacgtccaatcgacgaaaagactggggaagaaatcaagttgccagaaggtaag
acaatgcctgaacttgacgggaagccaggagaagaagttgaaattgatgtgaacgacttg
ccagacatcccaggttacgataagccaaagggtgacgaaaacggtaagatcaaggtgaag
gtaccagaagatggaaagccagctgacgtgccatacacaccagccgaagacaagaagaca
ccatcacgtccagtagatgaaaagactggggaagaaatcaagttgccagaaggtaagaca
atgcctgaacttgacggaaagccaggagaagaagttgaaatcgatgtgaacgacttgcca
gatatcccaggatacgacaagccaaagggagacgaaaacggtaagatcaaggtgaaggta
ccagaagatggaaagccagctgacgtgccatacacaccagccgaagacaagaagacacca
tcacgtccagtagatgaaaagactggggaagaaatcaagttgccagaaggtaagacaatg
cctgaacttgacggaaagccaggagaagaagttgaaatcgatgtgaacgacttgccagat
atcccaggatacgacaagccaaagggagacaagaacggtaagatcaaggttcaaattcca
gaagatggaaagtcagttgatgtcccatacacaccagccgaagataagaagacaccatca
cgtccagtagatgaaaagactggggaagaaatcaagttaccagaaggtaagacaatgcct
gaacttgacggaaagccaggagaagaagttgaaatcgacgtgaacgacttgccagatatc
ccaggttacgataagccaaagggagacaagaacggtaagatcaaggtgcaaattccagaa
gatggaaagccagctgacgtgccatacacaccagccgaagacaagaagacaccatcacgt
ccagtagatgaaaagactggggaagaaatcaagttaccagaaggtaagacaatgcctgaa
cttgacggaaagccaggagaagaagttgaaatcgacgtgaacgacttaccagatatccca
ggatacgacaagccaaagggagacaagaacggtaagatcaaggtgcaaattccggaagat
ggaaagtcagttgatgtgccatacacaccaaagaagaacacgacaccatcacgtccagta
gacaagaacactggtaaggaaatcaagacagacaagagtttcccaatcctagaaggaaag
ccaggagaagaagttgaaatcgacgtgaacgacttaccagaaatcccaggttacgataag
ccaaagggagacaagaacggtaagatcaaggttcaaattccagaagatggaaagtcagtt
gatgtgccatacacaccaaagaagaacacggcaccatcacgtccagtagacaagaacact
ggtaaggaaatcaagacagacaagagtttcccaatcctagaaggaaagccaggagatgtt
gttgaaatcgacgtgaacgacttaccagaaatcccaggttacgataagccaaagggagac
aagaacggtaagatcaaggttcaaattccagaagatggaaagtcagttgatgtcccatac
acaccaaagaagaacacgacaccatcacgtccagtagacaagaacactggtaaggaaatc
aagacagacaagagtttcccaattctagaaggaaagccaggagatgttgttgaaattgat
gtgaacgacttgccagatatcccaggttacgataagccaaagggagacaagaatggtaag
atcaaggttactattcctgaaaacggaatgattgactttggttacacaccaattgaagct
ggaaagcctggtcaatcacaacaaaacaacaatggttcaaagaacacacctgacaacaac
gctcctcaaaagggaaagtcaaagggtgatgcagcatatccaaacacaggatcagaaaca
aatgcacttgtttcagctcttggtgcagctatgttggctttgacaggattatttgcaggg
ttgactaagttgcgtaagaagtaa

DBGET integrated database retrieval system