KEGG   Weissella ceti WS74: WS74_0990Help
Entry
WS74_0990         CDS       T03280                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
wct  Weissella ceti WS74
Pathway
wct00473  D-Alanine metabolism
wct00550  Peptidoglycan biosynthesis
wct01100  Metabolic pathways
wct01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:wct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WS74_0990
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WS74_0990
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    WS74_0990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wct01011]
    WS74_0990
Enzymes [BR:wct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WS74_0990
Peptidoglycan biosynthesis and degradation proteins [BR:wct01011]
 Precursor biosynthesis
  Amino acid ligase
   WS74_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIM63242
UniProt: A0A075U105
LinkDB All DBs
Position
complement(1047386..1048543)
Genome map
AA seq 385 aa AA seqDB search
MTEKLNIALFFGGNSSEHDVSKRSAWNIYQAMDKDKYNVTVFLISKAGIIMNPEDSLRVF
EGEDEDPIVAAAMEKMDMTNPLAPIANLGAMDQIDLFYPVVHGNLGEDGTLQSLFRLLQK
PFIGPGTAASAMAFDKDLTKRVLNQAGIRNTKYVLLTDQTKDDYTYEELVEKLGTSTLFV
KAAKQGSSVGIHRVKNAEEYAAGLADALQYDYKVLVEAGLKSPREVFISILGNENPRASR
IGGIILPDAGEDVWYDYNNKFVDASGMTFELPATLDADLEAEITEMALATYKALGLVGLT
RMDFMVDQDGVPYLGEPNTLPGFTNISLYPQMWEVSGISYSALIDEIIAYGLAEFERNAE
LSYDFVALGEEKVGTKNINAERATD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaagttgaatattgcattgttctttggtgggaactcatcagaacacgacgta
tcaaagcgttcagcttggaatatttatcaagcaatggataaggacaagtacaatgtgact
gtctttttgatttcaaaggcaggaatcattatgaacccagaagactctttgcgtgtcttt
gaaggtgaagatgaagatccaatcgttgcagctgcaatggaaaagatggatatgacaaac
ccattggcaccaattgccaacttgggcgcaatggatcaaatcgatctattctacccagtt
gtccacggtaacttgggtgaagatggaacattgcaatcattgttccgtctattgcaaaag
ccattcattggtccaggaactgcggcgtcagccatggcctttgacaaggatttgacaaag
cgtgtgttgaaccaagctggtattcgtaacacaaagtacgtgttgcttacagaccaaact
aaggatgactacacatacgaagaacttgttgaaaagctaggaacaagcacattgtttgtg
aaggctgctaagcaaggttcatctgttggtattcaccgtgttaagaatgcagaagaatac
gctgcaggattggccgatgccctacaatacgactacaaggtacttgttgaagccggattg
aagtcaccacgtgaagtgtttatctcaatcttgggtaatgaaaacccacgtgcatcacgt
atcggaggaattatcctacctgatgctggtgaagacgtttggtacgactacaacaacaag
ttcgtggacgcttcaggaatgacatttgaattgccagcaactttggatgctgacttggaa
gctgaaattactgaaatggcccttgcaacttacaaggcgcttggtcttgttggtttgaca
cgtatggacttcatggttgatcaagatggtgtgccatacttgggagaaccaaacacattg
cctggatttacaaacatttctttgtatccacaaatgtgggaagtttcaggaatcagctac
tcagcattgattgatgaaatcattgcttacggattggctgaattcgaacgtaacgctgag
ttgtcatacgacttcgttgctcttggtgaagaaaaggtcggaactaagaacattaacgct
gaacgtgccactgattaa

DBGET integrated database retrieval system