KEGG   Wolbachia wNo (Drosophila simulans): wNo_04520Help
Entry
wNo_04520         CDS       T02641                                 

Definition
(GenBank) Pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wed  Wolbachia wNo (Drosophila simulans)
Pathway
wed00010  Glycolysis / Gluconeogenesis
wed00020  Citrate cycle (TCA cycle)
wed00620  Pyruvate metabolism
wed01100  Metabolic pathways
wed01110  Biosynthesis of secondary metabolites
wed01120  Microbial metabolism in diverse environments
wed01130  Biosynthesis of antibiotics
wed01200  Carbon metabolism
Module
wed_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wNo_04520
   00020 Citrate cycle (TCA cycle)
    wNo_04520
   00620 Pyruvate metabolism
    wNo_04520
Enzymes [BR:wed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     wNo_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGJ98875
UniProt: M9WRF7
LinkDB All DBs
Position
complement(531448..532710)
Genome map
AA seq 420 aa AA seqDB search
MPIEILMPALSPTMSKTGGKIVKWCKKEQDKVEIGDVIAEIETDKAIMEFESVDEGVLAK
ILVSEGTSGVPVNQLIALMLEEGEDKSALDLASAINTKVEKEVEADFSVSSNPSISSSSS
MSSQCVTLGSKKEDRATENRIKVSPLAKKIAQNEGVDIKRLKGTGPYGRIIKADVLEFLD
QTKSYERFEENTTVEVSNMRQVIAQRLVESKQNIPHFYLTVDCHVDKLISLKNEVNSANE
NNKVTINDLIIKAVAFSMKKFPDINSSWIDTKIVRYSNIDISIAVALEDGLITPIVKNAD
EKSVLSISKEVKDLVSRARSGKLKPEEFQGGGFTISNLGMFGIKTFSAIINPPQSCIMAV
GESKKQPVVIGEKIEIAEIMTVTLSVDHRAVDGALGAKFLNAFKYYIENPTVMLLEPLLL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaaatattgatgcctgctctttccccaacaatgagtaaaactggaggaaaa
attgtaaagtggtgtaagaaagaacaagataaagttgaaataggtgatgtaatcgctgaa
attgagactgataaagccataatggagtttgaatctgtcgatgaaggagttttggcaaaa
attttagtgtcggaaggaacaagtggcgtgcctgtaaatcaactgatagctctaatgtta
gaggaaggggaagataaaagcgcacttgatttagcttctgccatcaataccaaggttgag
aaggaggttgaagccgatttttcagtatcatccaacccttcgatttcatctagctcttca
atgtcatcccagtgcgtgacactgggatctaaaaaagaggatagagcaacagaaaataga
ataaaagtaagccccttagctaaaaaaatagctcaaaatgaaggtgttgatataaagcga
ttaaaaggtacaggtccatatggtcgtatcatcaaagctgatgtattagaatttttagat
caaactaaaagctatgagagatttgaggaaaatacaacagttgaagtaagtaatatgcgc
caagtgatagcgcagcgcctagttgaatctaagcaaaatattccacacttttatttaact
gtagactgccacgttgataagctaatatcgctcaaaaatgaggttaattcagcaaatgaa
aacaataaagtaacaattaatgacttaattataaaagctgtggctttcagcatgaaaaaa
tttcctgatataaactcatcgtggatagatactaaaatagtaagatactcaaatatagat
atctcaattgctgtagcgcttgaggatggactgattactcctatagtaaaaaatgctgat
gaaaaaagtgttttatctatatcaaaagaagtgaaagatttagtaagtagggcaagatct
ggaaaactaaagcctgaagaatttcaaggaggaggatttactatctccaacttaggcatg
tttggtataaaaactttcagcgctataatcaatccaccgcaatcttgcattatggctgtt
ggtgaatctaaaaaacagccggttgttataggtgaaaaaatagagatagcagagataatg
acagttactctctctgttgaccacagagcagttgatggagcactcggagcaaaattttta
aatgcctttaagtactatatagaaaatcctacggtgatgcttcttgagcctttattatta
taa

DBGET integrated database retrieval system