KEGG   Wolbachia wNo (Drosophila simulans): wNo_08620Help
Entry
wNo_08620         CDS       T02641                                 

Gene name
maeB
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
wed  Wolbachia wNo (Drosophila simulans)
Pathway
wed00620  Pyruvate metabolism
wed01100  Metabolic pathways
wed01120  Microbial metabolism in diverse environments
wed01200  Carbon metabolism
Module
wed_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:wed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    wNo_08620 (maeB)
Enzymes [BR:wed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     wNo_08620 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C ELFV_dehydrog ThiF AdoHcyase_NAD PglD_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGJ99254
UniProt: M9WTV5
LinkDB All DBs
Position
complement(941324..942643)
Genome map
AA seq 439 aa AA seqDB search
MNNDLDNTTKQEALKYHNKSGKPGKVSIIPTKPLSTQHDLSLAYSPGVAAPCLAIAKNPE
AVYDYTAKSNYVAVISNGTAVLGLGNIGPLASKPVMEGKAVLFKHFADIDAIDIEVDTEN
IEDFINAVRYLGPSWGGINLEDIRSPDCFIIEKRLNELMDIPVFHDDQHGTAVVVAAGIE
NALDIVGKKLRNVKIIMNGAGAAGIACLEILKSMGAKNIVLCDKQGVIHKDRKEDMNEWK
EKYAIDSKERSLLDAIKDADVFIGLSAKDVLSEEMLKSMGKDPIIFALANPDPEIRPEFA
KSVRPDAIIATGRSDYNNQVNNVMGFPYIFRGALDVHATTINDEMKIAAADAIAKLARES
VPNEISAAYGGRKMSYGREYIIPTPFDPRLISIVSPAVAKAAVTSGVARKEIEDWNEYAS
QLKSRLASALSTLNLLSSQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgatttagataacaccacaaaacaagaagcacttaagtaccataataaaagt
ggtaaacctggtaaggtatcgatcataccgacaaaacccttgtctacacagcatgaccta
tcacttgcttattcccctggtgttgcagccccatgccttgcaatagctaaaaaccctgag
gctgtttatgattacacggcaaaaagcaattatgtggctgtcatttcaaatggcaccgca
gtgctgggacttggcaatatcggtcctcttgcttcaaaacccgtcatggaaggcaaagct
gttttatttaagcattttgctgacattgatgcaattgatatagaagttgacacagaaaac
atagaagatttcatcaatgcagtaaggtatcttggtccaagttgggggggaataaatcta
gaagatataagatctcctgattgttttataatagagaaacgtctaaatgagttgatggat
attccggtgttccacgatgatcaacatggaactgcagtagttgttgcagctggtatagaa
aatgccctcgatattgttggaaagaaattaagaaatgtaaagatcatcatgaatggtgct
ggagcagctggtattgcgtgtttggaaatactgaagtctatgggtgctaagaacatagta
ctatgtgataaacaaggagtaatacacaaagacagaaaagaggatatgaatgagtggaaa
gaaaaatatgcaattgacagtaaagaacgttccttgctcgatgccataaaagatgctgat
gtattcatcggactctctgcaaaggatgtgctcagtgaagagatgttaaaaagcatgggt
aaagacccaatcatttttgctcttgctaatcctgatccagaaataaggcctgagtttgca
aagtctgtaaggccagatgcaataattgcaactggtagatcagactataacaaccaagtc
aataacgtaatgggatttccttacatattcagaggagcactcgacgtacatgcaacgaca
ataaatgatgaaatgaaaattgctgctgcagatgcaatagcaaagcttgcccgcgaatca
gtgccaaatgagatatctgcagcctatggcggtcgtaaaatgagctatggacgtgaatat
ataatacctactccatttgatccaagattaatttctatagtatctcctgctgttgcaaaa
gctgccgttacctcaggtgtggcaagaaaggaaatagaggactggaatgagtatgcaagt
caattaaaatctcgtcttgctagtgctctcagcacgctgaatctattgtcttcacaataa

DBGET integrated database retrieval system