KEGG   Weissella cryptocerci: EQG49_03265
Entry
EQG49_03265       CDS       T06454                                 

Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
wei  Weissella cryptocerci
Pathway
wei00730  Thiamine metabolism
wei01100  Metabolic pathways
wei01240  Biosynthesis of cofactors
wei04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:wei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EQG49_03265
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    EQG49_03265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wei03016]
    EQG49_03265
   03029 Mitochondrial biogenesis [BR:wei03029]
    EQG49_03265
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:wei02048]
    EQG49_03265
Enzymes [BR:wei01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     EQG49_03265
Transfer RNA biogenesis [BR:wei03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    EQG49_03265
 Prokaryotic type
    EQG49_03265
Mitochondrial biogenesis [BR:wei03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    EQG49_03265
Prokaryotic defense system [BR:wei02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   EQG49_03265
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-ProteinID: QBO35544
UniProt: A0A4P6YS80
LinkDB
Position
complement(694085..695254)
AA seq 389 aa
MIYFDNSATTQADPTAVETYSKVSANIWGNPSSLHNFGEQAFNLLEQSRKQIADLLGVSL
SEILFTSGGTEGDNWVIKGTAIEKRAFGKHLITSQVEHPAVQNSMEQLEQLGFEVTYLPV
DSEGRVSAADVKAAIRPDTILVSIMGVNNEIGAIQPIDEIGDVLMDYPKIHFHVDAVQTV
GKGLHDLVFHPRVDFATFSGHKFHAPRGIGFMYMKRGKRIAPLMTGGGQERNLRSGTENL
PAIAAMAKALRLVLDDEADKVERERSIRQAIMDHIKDLPNVTLFSQANDHFAPHILTFSL
DGVRGETIVHAFEEHGIYISTTSACSSKKEQASSTLMAMHTPEHLATSAVRVSLDASNTM
AQAEEFIKVFDVLYDGFQKVFAKNLADAR
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgatttattttgataactctgcgacgacacaagctgatccaacagctgtcgaaacatat
tcaaaggtttcagcaaacatctggggtaacccaagctcgcttcacaattttggtgaacaa
gcgtttaatttgttggaacaatcacgcaagcaaattgctgatttattgggagtgtcattg
agtgaaattcttttcacctctggtggtactgaaggtgataactgggttatcaagggaact
gcgattgaaaagcgggcctttgggaagcacttgattacgagtcaagtggaacacccagcg
gttcaaaactcgatggaacagctggaacaacttggctttgaggtgacttatttgccagtt
gatagcgaaggccgtgtttcagcggctgatgtcaaagccgcaattcgtcctgataccatc
ctagtttcaattatgggcgtgaataatgaaattggtgctattcaaccaatcgatgaaatc
ggtgatgtgttgatggattacccaaagattcattttcacgtggacgcggttcaaaccgtt
gggaaaggattgcatgatttggtattccacccacgagttgattttgcgacgttctctggg
cacaaattccatgcacctcgcggaattggatttatgtatatgaagcgtggcaagcgcatc
gctccattgatgaccggtggtggccaagaacgtaacttgcgttcagggacagaaaactta
cccgcaattgctgcgatggccaaggcgttacgtttagttcttgatgacgaagcggataag
gttgaacgtgaacgctcaattcgtcaagcaatcatggaccacattaaggatttgccaaac
gtgactttgttctcacaagccaatgaccactttgcgccccacattttgacattctcatta
gacggtgtccgtggtgaaacaattgtccatgcttttgaagaacacggaatctacatttca
acgacttcagcctgttcaagtaaaaaagaacaagcttcaagtactttgatggccatgcac
acgcctgaacacttagcaacttctgccgtgcgagtatcactcgacgcctcaaacacaatg
gcgcaagctgaagaatttattaaagtgttcgacgttttgtatgatggatttcaaaaagtt
ttcgctaagaacttagccgacgcaagataa

DBGET integrated database retrieval system