KEGG   Wenyingzhuangia fucanilytica: AXE80_00200Help
Entry
AXE80_00200       CDS       T04444                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00240  Pyrimidine metabolism
wfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AXE80_00200
Enzymes [BR:wfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AXE80_00200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: ANW94807
UniProt: A0A1B1Y241
LinkDB All DBs
Position
complement(44476..45060)
Genome map
AA seq 194 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLRRAQIAKQRIEIFKPSVDTRYDEEN
VVSHDEKYIRSTPVPAAANIRLLANYVDVVGIDEAQFFDDEIVSVCNDLANKGIRVIVAG
LDMDFKGKPFGSMPNLMATAEYVTKVHAICTKTGNLAHYSHRKNDSEKLVMLGENENYEP
LSRAAFYKANNKNN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaacactgtaaaccataaagaacaatttggatggattgaagtcatctgc
ggatctatgttttcgggtaaaaccgaagaattaattcgtagattaagacgtgctcaaatt
gctaaacaacgtatagaaatctttaaaccttctgtagacactcgttatgatgaggaaaat
gttgtttctcacgatgaaaaatatattcgttccacacctgttcctgcagcagctaatatt
cgattattagctaactatgtagatgtggtaggaattgatgaagcacagttttttgatgat
gaaattgttagcgtttgtaacgatttagcaaacaaaggtataagggttattgttgctggg
ttagatatggattttaaaggaaaaccttttggatctatgccaaatttaatggctaccgca
gagtacgtaaccaaagtccacgctatttgcaccaaaacaggaaacttagcccattacagt
caccgaaaaaatgacagtgaaaaattagtgatgttaggagaaaatgaaaactacgaaccg
ctaagtagagctgctttttacaaagcaaacaacaaaaacaattag

DBGET integrated database retrieval system