KEGG   Wenyingzhuangia fucanilytica: AXE80_00300
Entry
AXE80_00300       CDS       T04444                                 

Definition
(GenBank) hypothetical protein
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
wfu  Wenyingzhuangia fucanilytica
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXE80_00300
Enzymes [BR:wfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     AXE80_00300
SSDB
Other DBs
NCBI-ProteinID: ANW94827
UniProt: A0A1B1Y261
LinkDB
Position
complement(62654..64195)
AA seq 513 aa
MKLTIKKVGLFMAMFAGISCANEIEQEITANNQQEFNLSREAKTGITSTGYNSTNYFQPP
TNLPTKNFTGSTSTQLQTLINNSSTGAIIKIPKKTYNWGEIKLKSKIQLEIESGTIIKPS
NNNIKRIFSIGSSGNGTRVTDVSIIGVGGKFTIDLSATANLNQNMAVIKMGRVSNFKISN
FIIKDRRTSLASILLNYIPSNSDNEPYPKNGVIEKINQTGISHTGYGLIQAYSASNVLFK
NLYCKGGVTLRLETDDKTMKDAVKNGGKLFGLRNIYADMIKCTSGLCPIMFSPHFTENGK
ITARNITATGCAFAVRVEHGFIEVFDTNKTYALTSSGGNQFKNFIAGKISGTGNSSKFIG
NQYKRANGTQWAIRLSDASINGSLDPYITNQIGYLKNGSFESTTIENVTTIYKPTNAKLK
QSFLPFIPCNDWTSKIKNPTDTGMGNGFEYYGPSLGERFDNTNGTNSNGNYIINVNGTTT
RFSTVRNILYNTPTACTSNAYGTIPTTSNSPGL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaaattaactattaaaaaagtagggctatttatggctatgttcgcaggaatttcttgc
gctaacgagattgaacaagaaatcaccgcaaacaatcaacaagaatttaacctctctaga
gaagctaaaaccggaataacttcaacaggatataattctacaaactattttcaaccccca
accaacctacccacaaaaaatttcactggaagtacaagtacacaacttcaaacacttatt
aataatagcagcactggagccattattaaaatccctaaaaaaacgtataactggggagaa
atcaaattaaaatccaaaatacaattagaaatagaaagtggaactattattaaaccatct
aacaataatattaaacgcattttcagtattggtagttctggtaatggtactagagttact
gatgttagtattataggtgtaggcggaaaatttacaatagacctatctgccaccgctaac
ctaaaccaaaacatggcagtgataaaaatgggaagagtatctaattttaaaatctctaat
tttattattaaagacagaagaacttcactagcatcaatcttactaaattacatcccatca
aactctgacaatgaaccttatcctaaaaatggtgtcatcgaaaaaattaaccaaacagga
atttcacacacaggttatgggttaatccaagcgtattctgcatcaaatgtattatttaaa
aatctatattgtaaaggtggagtaactcttagactagaaactgatgacaaaaccatgaaa
gatgctgttaaaaatggtggtaagttatttggattgagaaatatttacgcagatatgata
aaatgtactagtggactttgccctatcatgttttctcctcactttactgaaaacggaaaa
attacagcaagaaatattaccgcaactggatgtgcttttgctgtaagagttgaacacggg
tttattgaagtttttgacactaataaaacttatgctttaacctcatctggaggaaaccaa
tttaaaaactttattgctggtaaaatatcaggaactggaaactcttctaaattcataggc
aaccaatacaagagagctaatggcacacagtgggctattagattatctgacgcttctata
aacggctctctagatccatacatcactaatcaaattggatatttaaaaaatggtagtttt
gaaagcacaaccatagaaaatgtaacaacaatttacaaacctacaaacgccaaattaaaa
caatcctttttaccatttatcccttgtaatgattggactagcaagattaaaaatcctact
gacacaggaatggggaatggttttgaatactatggaccttctttaggagaaagatttgac
aacacaaatggtaccaactctaatggaaactacatcatcaatgtaaatggaacaactact
aggttttcaactgtgagaaacattctttacaacaccccaaccgcctgtacaagtaatgca
tatggtacaattcctaccacttctaatagtcctgggttataa

DBGET integrated database retrieval system