KEGG   Wenyingzhuangia fucanilytica: AXE80_02635Help
Entry
AXE80_02635       CDS       T04444                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00010  Glycolysis / Gluconeogenesis
wfu00020  Citrate cycle (TCA cycle)
wfu00620  Pyruvate metabolism
wfu01100  Metabolic pathways
wfu01110  Biosynthesis of secondary metabolites
wfu01120  Microbial metabolism in diverse environments
wfu01130  Biosynthesis of antibiotics
wfu01200  Carbon metabolism
Module
wfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXE80_02635
   00020 Citrate cycle (TCA cycle)
    AXE80_02635
   00620 Pyruvate metabolism
    AXE80_02635
Enzymes [BR:wfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AXE80_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C
Motif
Other DBs
NCBI-ProteinID: ANW95247
UniProt: A0A1B1Y3B8
LinkDB All DBs
Position
complement(599055..600698)
Genome map
AA seq 547 aa AA seqDB search
MATIINMPRLSDTMTEGTVAQWLKKVGDKIEEGDILAEIETDKATMEFESFNEGVLLHIG
LEDGETAPVDSLLAIIGEEGEDISGLLGGGSAEPAAEAPKTEEAAPVAEEAPASEEVAIP
EGVIVVTMPRLSDTMTDGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLYV
GLEEGETAPVDSLLAIIGEAGTDVSAVAANFGKASAPAPKAAPAAEAPKAAAAPAPAKTE
APKASAPTATKKVSAINSENGRIVASPLAKALAEEKGINLAKVVGTGEGGRIVKVDIENY
TPATEAAAPAAKAVAAAPAGEISQREEKNSNMRKAIARALDKSQTENVNFTISLDVDMDN
AMASRKQINELPDTKVSFNDLVVKASAMALRKHPQINTEWTVEKTIYNEHIAIGVAVAIE
DGLVVPVIPFTDTKSLTQIGAEVKDLAIKAKNKKLTPAEMSGSTFTVSNLGMFGVDNFTS
IINQPNSAILSVGGIKQKPVVKNGEIVVGNVMNLTLSCDHRTIDGAVGAAFLNTLKQYIE
NPVTMIA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctactataattaacatgccacgtttgagtgatacgatgactgaaggaaccgttgct
caatggcttaaaaaagttggagacaaaattgaagaaggtgacattttagctgaaatcgaa
actgataaagctactatggaatttgaatcttttaacgaaggtgttttattacacattggt
ttagaagatggagaaacagcacctgttgatagtttattagctatcattggtgaagaaggt
gaagacatttctggattattaggtggtggttctgctgaacctgctgctgaagcaccaaaa
actgaggaagctgctcctgttgcagaagaagctcctgcaagtgaagaagttgctatccct
gaaggagtaattgttgtgacaatgcctcgtttaagtgatacaatgactgatggtactgtt
gcttcttggttaaagaaagttggagacaaggttgaagaaggtgatattttagctgaaatc
gaaacagataaagctacgatggagtttgagtcttttaacgaaggaactcttttatatgtt
ggactagaagaaggagaaactgctcctgttgatagtttattagcaattattggtgaagct
ggaactgatgtttctgctgtagctgctaattttggtaaagcaagtgctccagctcctaaa
gctgctcctgctgccgaagcgccaaaagctgctgccgctcctgctccagcaaaaacagag
gctcctaaagcatctgctcctactgctactaaaaaagtaagtgcaatcaattctgaaaac
ggaagaatcgttgcctctcctttagctaaagctttggctgaagaaaaaggaatcaactta
gcaaaagttgtaggtactggtgaaggtggaagaattgtaaaagtagatatcgagaactat
actcctgctactgaagctgctgctcctgctgcgaaagctgtagctgctgctcctgctgga
gaaattagccaaagagaagagaaaaactctaacatgcgtaaagcaattgctagagcttta
gacaaatctcaaacggaaaatgtaaactttactattagtttagatgtagacatggacaat
gccatggcttctcgtaaacaaattaatgagttacctgatactaaagtttcttttaatgac
ttagtagtaaaagcttctgcaatggcattgagaaaacacccacaaatcaatactgaatgg
actgttgaaaaaacaatctataacgaacatattgctattggtgttgctgttgctattgaa
gatggtttagtagttcctgtaattccttttacagacactaagagtttaactcaaattggt
gctgaagtaaaagacttagctatcaaagctaaaaacaaaaagttaactcctgcagaaatg
tctggaagtacttttacagtatctaacttaggaatgtttggtgtagataactttacttct
atcatcaatcaacctaactcagctattttatctgttggtggtatcaaacaaaaacctgtt
gttaaaaacggagaaattgttgttggtaacgtaatgaatttaactttgtcttgcgaccac
agaactattgatggtgctgttggagctgctttcttaaatacattaaaacagtatatagaa
aaccctgttactatgattgcttaa

DBGET integrated database retrieval system