KEGG   Wenyingzhuangia fucanilytica: AXE80_08005Help
Entry
AXE80_08005       CDS       T04444                                 

Definition
(GenBank) hypothetical protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00052  Galactose metabolism
wfu00511  Other glycan degradation
wfu00600  Sphingolipid metabolism
wfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AXE80_08005
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AXE80_08005
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AXE80_08005
Enzymes [BR:wfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AXE80_08005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 LPD15
Motif
Other DBs
NCBI-ProteinID: ANW97471
UniProt: A0A1B1Y9L1
LinkDB All DBs
Position
complement(1984334..1986793)
Genome map
AA seq 819 aa AA seqDB search
MKKYLLSILCFVSFITYAQRETTSFNENWKFARFGEMPDGSTKAEPKDIDEVAYDDAHWR
ILNLPHDWGIEGPFRADLPNQTGKLPWAGIGWYRKVFTATESDLSKKVFIEFDGAMSNTS
VFVNGSYVGEWAYGYSSFRFEISRYLKQGNNTIAVRLNNKAASSRWYPGGGIYRNVRLVK
TNPTHIAHWGTFVITPNVSNKEATVEITTEVVGDKKDVQVMHEIYTTGKNAVKVAEQKIP
YYQPSNITISNPKLWDLENPNLYTLKTTLTKNGKILDVYNTTFGIRSIEYNANGFFLNGK
KVRMNGVCQHHDLGPLGTAVNVRAMERQIEILKSFGVNAIRTSHNPPAPEFLEMCDKMGV
LVQVEAFDVWGKKKVDNDYASLFGAWHEKDLITMVKRDRNHPSVVMWSTGNELIELREGN
DAPLAAKLADIIRSVDTTRPTTFGNSRPEAATNGFQFTADVFGFNYKPHMYEEFRKENPN
MPLYGSETASTISSRGEYFFPVNFDDKKQGNGGFFQVSSYDYSAPNWADIPEKDFEAEDK
FPWLFGQFVWTGFDYIGEPTPYNKDKTNLLNFSDPKEKARMKAELAKMGKQIPPRSSYFG
IVDLCGFPKDRYYLYQSKWKPELPMAHILPHWNWPERVGKVTPVLVYTSGDEAELFLNGK
SLGRKKKGQYEYRLIWKDVVYQKGELKVVAYKNGKKWATEKVKTTGTANKVSLTADRTKI
KADGQDLSFITVEIKDKKGQTVPRTHNVVNYTISGPGEIVAVGNGDTTSHESFQATTRKV
FNGMALVVVKSKKGQTGKITVTATSKGLKTTKVNLTVEE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
ataaagaaatatctattatcaattttatgctttgtgtcattcataacgtatgcacaaaga
gaaactacatcatttaatgaaaactggaaatttgctcgttttggagaaatgccagatggt
tctaccaaagctgaacctaaagatatagatgaggtagcttatgatgatgcccattggaga
attttaaatttacctcatgattggggaatagaaggtccttttagagcagatttacctaac
caaacaggaaagttaccatgggcaggaataggatggtatcgtaaagtatttaccgctaca
gagtcagatttatctaaaaaagtatttatagaatttgatggggctatgtctaacacttct
gtttttgtaaacggaagttatgtaggagagtgggcttacggatactcttcttttagattt
gaaatttctcgttatttaaaacaaggaaacaataccattgctgtaagattaaataacaaa
gcagcatcttctcgttggtaccctgggggaggaatttacagaaatgtacgtttggtaaaa
accaatccaactcatattgctcattggggaacttttgtaatcacacctaacgtttctaac
aaagaagctactgtagaaattacaacagaagttgttggagataaaaaagatgttcaggta
atgcatgaaatttatacaacaggtaaaaatgcagtaaaagtagcagagcaaaaaatacca
tactatcaaccaagtaacattactatttcaaatccaaaattgtgggatttagaaaatcca
aatctatatactttaaaaactactttaactaagaacggaaaaattttagatgtgtataac
accactttcggaattcgttctatagaatataatgccaatggttttttcttaaacggtaaa
aaagtaagaatgaatggtgtttgtcaacatcacgatttaggtcctttgggaaccgcagta
aacgtgagagcaatggaacgtcaaatagagattttaaaatcttttggagtcaatgctatt
cgtacgtctcataacccacctgctccagaatttttagaaatgtgtgacaaaatgggagtt
ttggtacaagtagaagcttttgatgtttggggaaagaaaaaagtagataacgattatgct
tctttatttggtgcttggcacgaaaaagatttaatcacgatggtaaaaagagatcgtaat
catccgtctgtagtaatgtggagtacaggaaatgaattaattgaattaagagaaggaaac
gatgctcctttggcagcaaaactagcagatattattcgctctgtagatactactagacct
actacttttgggaatagtagacccgaggctgcaaccaatggatttcaattcacagcagat
gtttttggatttaattacaagcctcatatgtacgaagagtttagaaaagaaaatcccaat
atgccattgtatggaagtgaaaccgcttctacaattagctctagaggagaatactttttt
cctgtaaactttgatgataaaaaacaaggaaacggaggtttctttcaggtaagtagttac
gattattcggctccaaattgggcagatattcctgaaaaagattttgaagcagaagataaa
ttcccttggttgtttggtcagtttgtatggacaggttttgattatattggagaacctact
ccttataacaaagacaaaaccaacttgttaaacttttcggatcctaaagaaaaagctaga
atgaaagccgaattggctaaaatgggtaaacaaattccaccacgtagttcttattttgga
attgtagatttatgtggttttcctaaagataggtattatttgtatcaatctaaatggaaa
ccagaattgccaatggcacatattttaccacattggaattggccagaaagagtaggaaaa
gtaactcctgttttggtgtatacttctggtgatgaggcagaactgtttttaaacggtaaa
tctttagggagaaaaaagaaaggtcaatatgaatatagattgatttggaaagatgtagtt
tatcaaaaaggagaattaaaagtagttgcctataaaaacggaaaaaaatgggctacagaa
aaagtaaaaactacaggtactgcaaacaaagtttctttaacggcagacagaactaaaata
aaagcagacggacaagatttgtcttttataactgtagaaattaaagacaaaaaaggacaa
acagttcctagaactcacaatgttgttaattatactattagcggacccggagaaattgtt
gctgtaggaaatggcgatactacaagtcacgaatcttttcaagctaccacaagaaaagtg
tttaacggaatggcattggttgtggtaaaatctaaaaaaggacaaacaggaaaaattaca
gtaacagctacttctaaaggattaaaaaccacaaaagttaatttaaccgtagaagaataa

DBGET integrated database retrieval system