KEGG   Wenyingzhuangia fucanilytica: AXE80_09590Help
Entry
AXE80_09590       CDS       T04444                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00564  Glycerophospholipid metabolism
wfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AXE80_09590
Enzymes [BR:wfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AXE80_09590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA NAD_binding_8 DUF4881 Thi4
Motif
Other DBs
NCBI-ProteinID: ANW96517
UniProt: A0A1B1Y6Z3
LinkDB All DBs
Position
2393998..2395539
Genome map
AA seq 513 aa AA seqDB search
MKKILENTQWDILIIGGGATGVGTAIDAASRGYKTLLVEKEDYGKGTSSKSTKLVHGGVR
YLQQGNFSLVLEALKERAILKRNAPHIVHDLKFVVPTYDWWESPFYGIGLKLYDWLAGKE
GFGDSELISKEETIQFIPTVTQEGLRGGVIYHDGQFDDTRLLINMMQTAKEQGATVLNYT
QFLEFTKNDGELIDGAIIQNIHTLEKYTIRAKSVINATGVFSDSIRQKDQTNIHKIITSS
QGVHIVLDKEFLPGDTAIMIPHTDDGRVLFAVPWHDKILIGTTDTPVTKYSSEPLAKEQE
IEFLLTHTAKYLTKNPTKKDVKSIFVGLRPLVKSGNAEDTAEISREHVIEVSKSGLISIA
GGKWTTYRKMAEDVVDKATMVAILPFVKSETEFLNIHGHRKLKSETNPLAIYGTDEKQIK
KLFTSNPELKEKIHPNHPYIKAQIVWAVQNEDAKTIEDFLARRIRLLFLDAKATIEASEM
VANIMSVELKQSNAWIQNQISEFKKLAQQYLLK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactagaaaacacacaatgggatatcttaattattggaggtggcgctaca
ggagttggaactgctatagatgctgcttctagaggatacaaaactttactggtagaaaaa
gaggattatggaaaagggacttctagtaaaagtactaaattggttcacggaggtgttcgt
tatttacaacaaggaaacttttcgttagtcttagaagctttaaaagaacgtgccatttta
aaaagaaatgctccacatattgtacacgatttaaaatttgtagtaccaacatatgattgg
tgggaaagtcctttttatggtattggtttaaaattatatgattggttagctggaaaagaa
ggttttggagattctgaattgatttctaaagaagaaactattcaatttattcccacagta
actcaagaaggtttacgtggcggagtaatttatcacgatggtcaatttgatgatactcgt
ttactcattaacatgatgcaaactgccaaagaacaaggagctacagttttaaattatact
cagtttttagagtttacaaaaaatgatggtgaattgattgacggagctattattcagaat
atacataccctagaaaaatatacaattcgtgctaaatcagtcatcaatgcaacaggtgta
ttttctgatagtattagacaaaaagatcaaacaaatattcataaaataataaccagtagt
caaggtgttcacattgttttagacaaagagtttcttcctggagatactgctattatgatt
ccacatactgatgatggtagggttttatttgcagttccttggcatgataaaatccttatt
ggaacaactgatactcctgtaactaaatattcttctgaacctttagccaaagagcaagaa
atagaatttttattaacacatactgcaaagtacctaactaaaaatcctactaaaaaagat
gtcaaaagtatttttgtaggtttacgacctttggtaaaaagtggaaatgcagaagatact
gcggaaatttctagagaacatgttatagaagttagtaagagtggattgataagtattgct
ggaggtaaatggactacttatagaaaaatggctgaggatgttgttgacaaagcaacaatg
gtcgcgatattgccttttgttaaatctgaaaccgaattcttaaatattcatggacataga
aaattaaaatcagaaaccaatcctttggctatttatggaactgatgaaaaacaaataaaa
aagctgtttacttctaatcctgaattaaaagaaaaaattcaccctaatcatccttatata
aaggcacaaattgtttgggctgtacagaatgaagatgctaaaactattgaagatttttta
gctagaagaattcgtttgttatttttagatgccaaggcgaccatagaagcatctgaaatg
gttgctaatataatgtctgtagagttaaaacaaagtaatgcttggatacagaatcaaata
tcagagtttaaaaaactagcacagcaatatttattgaaataa

DBGET integrated database retrieval system