KEGG   Wenyingzhuangia fucanilytica: AXE80_12065Help
Entry
AXE80_12065       CDS       T04444                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00620  Pyruvate metabolism
wfu00680  Methane metabolism
wfu01100  Metabolic pathways
wfu01120  Microbial metabolism in diverse environments
wfu01200  Carbon metabolism
Module
wfu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXE80_12065
  09102 Energy metabolism
   00680 Methane metabolism
    AXE80_12065
Enzymes [BR:wfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AXE80_12065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Gluconate_2-dh3
Motif
Other DBs
NCBI-ProteinID: ANW96968
UniProt: A0A1B1Y8B8
LinkDB All DBs
Position
2943149..2945743
Genome map
AA seq 864 aa AA seqDB search
MSKQTKLSRFNDSVLAKYQVYNSVFATLPFDSVEKTGTLLPLFNESCIEGFKNGKTPTEI
VDEFFTKYKSDSTEEDKISFLFKFIQYIERQVVLFDAIEDAAFPIVNNMAGVGTLRNIKE
EASSKRVRNELKHYLEEFKTRLVLTAHPTQFYPGTVLTILTDLQEAIKNDDLSLIKKLLA
QLGRTTFFAEKKPTPYDEAISLIWYLENVFYHSISKIYDYIHYHLFDGEDIKNEIITLGF
WPCGDRDGNPFVTTETTLRVARKLRQTILKNYFRDVRQLKRRLTFPGVYEIMNEIESALY
DSCITENSPVRISVKSLLSKMNAIKKTLKEEHSNLFVEEVDSFINKVKIFGFHFATMDIR
QDSRVHHDVFTGIVKELQEKGDNTFPKNYLELSPDEQIQVLAKVKGDIDPEQFSEEMVVR
TLGSMRAISTIQEDNGERGANRYIISNNQTALNVMETFAMLNLSGFEEGLKVDVAPLFET
VDDLEIAPQVMRQLYSIPEYREHVAARGNKQNIMLGFSDGTKDGGYLMANWGIYKAKEEL
SKVSREFGIKVIFFDGRGGPPARGGGKTSKFYASLGENIENKEIQLTIQGQTISSNFGNL
DSSQYNIEQLLGAGITNKIFNDPMNASLSDEQKGLMEDLAELSFKAYSDFKNHEMFIPYL
ERMSTLKYYGKANIGSRPSKRAKSDSLNFGDLRAIPFVGSWSQLKQNVPGFFGVGTAFKK
YKDAGEFDKVQDLYNNSNFFKTLLENSVMSMEKSNFALTNYMAKDEEFGAFWNIIHDEYL
LTKELLLELAGHKELMQNFPDGKASIAVRDSIVLPLLTIQQYALREVQLMNKPGATPDQK
RLETFEKIVTRSLFGNTNASRNSA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaccaaattatcaagattcaacgatagcgttcttgctaagtatcaggtt
tacaatagtgtttttgctactttaccctttgacagtgtagaaaaaacaggaacattgtta
cctttatttaacgagagctgtatagaaggttttaaaaacggaaaaactcccacagaaatt
gtagatgagttctttactaaatacaaatctgattccacagaagaagacaaaattagtttc
cttttcaagtttattcaatacatagaacgtcaagttgtattgtttgatgctatagaagat
gctgctttccctattgtaaacaatatggctggagtaggaactttaagaaatattaaagaa
gaagcaagttctaaacgagttagaaacgaacttaaacattatttagaggaatttaaaact
agattagttttaacagctcacccaacacaattttacccaggtactgttttaacaatttta
acagacttacaagaagctattaaaaatgatgacttaagcttaattaagaaattattagct
caattaggtagaactacattttttgcagagaaaaaaccaactccatatgatgaagctatt
agcttaatatggtacttagaaaatgtattttaccactctattagtaaaatctacgattat
attcactaccatttatttgatggtgaagacatcaaaaacgaaattattactctaggattc
tggccttgtggagatagagatgggaacccatttgtaactacagaaacaactttaagagtt
gctagaaaactaagacaaactattttaaagaactactttagagatgttcgtcaattaaag
cgtagacttactttcccaggagtttacgaaattatgaacgaaattgaatctgctttatac
gatagctgtattacagaaaattctcctgttagaatttcagtaaaatcgttattaagcaag
atgaatgcgattaagaaaactttaaaagaagagcacagtaatttatttgtagaagaagta
gatagctttatcaacaaagtaaaaatctttggattccactttgctacaatggacattcgt
caagacagccgtgtacaccacgatgtatttactggaattgttaaagagttacaagaaaaa
ggagataacactttccctaaaaactacttagaattaagtccagatgaacaaattcaagta
ttagctaaggtaaaaggagatatcgatccagaacaattctctgaagaaatggtagttaga
actttaggttctatgagagcaatctcaaccatacaagaagacaatggagaaagaggtgct
aatagatatattattagtaacaaccaaactgccttaaacgtaatggaaacattcgctatg
ctaaatctttctggatttgaagaaggtttaaaagttgatgttgctccgttatttgaaaca
gtagatgacttagaaattgctcctcaggtaatgagacaattatattctattccagaatac
cgtgagcatgttgcagctagaggaaacaaacaaaacattatgttaggattctctgatggt
actaaagacggtgggtatttaatggctaactggggaatctacaaagcaaaagaagagtta
tctaaagtatctcgtgaattcggaattaaagtaatattctttgacggacgtggtggacca
cctgctcgtggaggaggaaaaacttctaaattctacgcttctttaggagaaaatattgaa
aataaagagattcagttaaccattcaagggcaaactattagttctaactttggtaactta
gattcttctcaatacaacatagaacaattattaggagctggtattaccaacaaaatattt
aacgatccaatgaacgcatctttatcagatgagcaaaaaggattgatggaagatttagca
gaattaagctttaaagcatattcagactttaagaaccatgaaatgtttattccttactta
gaaagaatgagtactttaaagtactacggtaaagcaaacattggatctcgtccatctaag
cgtgctaaatcagattctttaaactttggtgatttaagagctattccttttgttgggtct
tggtcacaattaaagcaaaatgtaccaggattctttggtgtaggaactgcatttaaaaag
tataaagatgctggtgagtttgataaagttcaagacttatacaacaactctaacttcttt
aaaacattgttagaaaacagtgtaatgtctatggaaaaatcaaactttgctttgactaac
tacatggcgaaagatgaagaatttggtgcattctggaacattattcacgatgagtattta
ttaactaaagaattgttgttagaattagcaggtcacaaagaattgatgcaaaacttccct
gacggaaaagcatctattgctgtacgtgattctattgtattacctcttttaactatacaa
caatatgctttaagagaagtacaattaatgaacaagcctggtgctacacctgatcaaaaa
cgattagagacttttgaaaaaattgtcactagatctttatttggtaacaccaacgcaagt
agaaactctgcttaa

DBGET integrated database retrieval system