KEGG   Wallemia ichthyophaga: J056_000219Help
Entry
J056_000219       CDS       T03457                                 

Definition
(RefSeq) Histone-lysine N-methyltransferase, H3 lysine-4 specific
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    J056_000219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:wic03036]
    J056_000219
Enzymes [BR:wic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     J056_000219
Chromosome and associated proteins [BR:wic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     J056_000219
   HMT complexes
    COMPASS/SET1 complex
     J056_000219
    COMPASS/SET1 complex (yeast)
     J056_000219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SET_assoc N-SET RRM_1 BRAP2
Motif
Other DBs
NCBI-GeneID: 20373171
NCBI-ProteinID: XP_009265892
UniProt: R9ARJ7
LinkDB All DBs
Position
Unknown
AA seq 1374 aa AA seqDB search
MVDEMDDRYSAVGGSANDLHSHNDRSSLFDNYARKHGTSSNNSNGNGNRTHGNHGNHGSY
NNTYKPTRNDNSSVMRVYEHRPSLNHTHTQSHPVSISDDDKYSDSLGRNSPKKRVSRGAE
RVFADNGVVPVKYDDSSPTATRTQSQHPDLNYKDSRLAAQARSALEKQKTVNSKWSTSAE
GSYSRFDSDRQPTRYDSRTFSPSTSYAAAHRDRGRDFRTNFESDRDYDREYEREYQREYE
PVYKRDYHYQHHYPHEYDHHYDYDGNLQQLDYRRRPPPGYTGGYRGNSYNPHITAQRPPP
KKRHTPPRTSRRPSPRTYRDRDYDFDYTQPSSQYPPANIAKHELPAKPVSIYSPMPQSSI
PPHKRQYSLEREESPSKSFQLVDPTRPPIKPEGKQNYLIKDGKKRFDGDGLLTQPSDPRK
NRHLFVERINHEKNRNRYSNNLIFLKSFIHDEHSLQPPPTSCICIKGIPSALTENDLNTY
FKGKYKTFKSMKLHYDRSTGAFLGLVWISFRKYTDAEACIDEFHGAKNFNLGKAHIGSVP
PIQVRPDEDGNVYHKVVDDFYKKREENESRARREREEKRRKEASRKAAESQASQVNQAPK
VLPTPSTKIGFNPNQQTPTRPGPGQSVLGKTSWLSSASKPSNLAHTPSHPKPLEMAKAGS
EDTEDEDEWDDLHGDEIFRGRSDNMLTRKKESPVKNSQHHPDAIQQDAHQAEISIEEKIK
KNGNAHIFIDKSSLPVHSVDVVDVRAFFGQFKVSDVLKNDDGWFVLFTKPGIAGRAMTTS
DGKQCSGFTMHLQLRDPRAQQLETLNDINKDKVKLSDKRTFSEEPHDSHDMDDMDVVLKL
NRPLQSQKSKRGRVMKSKNKHMVDFTSSEGESGDEKQSTVVEKEPAFERFEFAEGVDGIR
KNVADVAYDGRDDRAHVNGHVKRDFDTVNQHNNVEIAAKDNQNDASTFVDNLNNAEAGFI
GNQSIYEIKTTNKPADMIKTESEQTTSTDNAPDNKFRSKKASKAKKVPVSKRKTSKATKK
SSKNALKTPPPAASSAKSEESAQSDISEEADDPHHLYTPKNTIPTPPLNVPPFDPISDPS
RPYTKTDILSSDLVNSEEDLYYLKTVIDREARKLPTTIQELLQCHNYTPPDWKDDLRFSI
FNSPEKTDENAPWRPPVHATGSARSEGIYPIPETEKAFYLPQRNKVTKASRQHGDRDNVS
SRANRSNARSLVHGLTGGATDGEILKFNQLRTRKKELKFAKSSIHSWGLYSCQVIPKGEM
VIEYVGEVVRQQVADRREKAYEKQGIGSSYLFKIDDDNIVDATMKGSVARLINHCCQPNC
TAKIITILGEKKIIIYAKEEISPGDEITYDYHFPIEDEKIPCLCGVDGCRGSLN
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgagatggacgacagatacagcgcggttggtgggagtgcgaatgacttacac
agtcacaatgatagatcttctctgtttgacaattacgcacgaaaacatggtactagtagt
aacaatagcaatggtaatggcaatcgcactcatggcaatcatggcaatcatggctcctac
aacaatacttacaaacccactcgcaacgacaattcttctgttatgagagtatacgagcat
cgacccagcctcaatcacactcacactcaaagtcatccagtcagtatcagtgacgatgac
aaatatagcgatagccttgggcgtaattcacctaaaaaacgcgtctctcgtggtgctgag
cgtgtttttgcagataacggtgttgttccagtcaagtatgatgatagcagtcccacggca
acgcgcactcaatcgcaacatcctgatctcaattataaggacagccgtctcgctgcacag
gctagaagtgcactcgaaaaacagaaaactgtcaattcaaaatggtccacatcggcagaa
gggagttattcaaggttcgattctgatagacagcccactcgttatgactctcgtacattt
tcaccttcaactagttacgctgctgctcatcgcgatcgtggtcgtgattttcgtacgaat
tttgagtctgatcgtgattatgatcgtgaatatgaacgtgagtatcaacgtgagtatgag
ccagtttacaagcgtgattatcactaccaacatcactacccacacgaatacgatcatcat
tacgactacgacggcaatcttcagcagctcgattatagacgccgtcctccacctggatac
actggcggatatagaggtaacagctacaacccgcatataactgcacaaaggcctcctccg
aaaaagcgacatactcctcctagaacctctcgcagaccctccccaagaacctatcgcgac
agggattatgatttcgattatacccagccatcttctcaatacccccctgcaaacattgcg
aaacatgaactcccagcaaagccagtcagtatatactcgccaatgcctcaatcctctata
ccaccccacaaacgacagtactcacttgaacgagaagagtcgccttcaaaatcatttcag
ctggtcgatccaactcgaccaccaataaagccagagggaaaacaaaactacctcataaaa
gacggcaaaaagcgttttgatggtgatgggctgttgacgcagcccagtgatccgcgcaag
aataggcatttgtttgtcgagcgaatcaaccacgaaaagaatagaaacaggtattcaaac
aacttgatctttctcaagagctttatacacgacgaacattccttgcaacctccaccaaca
tcttgcatctgtataaagggcataccatctgcactcactgaaaatgatcttaacacttat
ttcaaaggaaagtacaaaacgttcaaaagtatgaaattacattacgatagaagtaccggt
gctttcttgggtcttgtttggattagttttcgtaaatacactgacgctgaagcgtgtatc
gatgagtttcatggagccaaaaatttcaacctcggtaaggcacacataggctcagttcca
ccgatacaagtccgtccagatgaggatggcaatgtataccataaagtagtcgatgacttt
tacaagaagcgcgaggagaatgaaagtcgagctagaagggaaagggaggagaagaggagg
aaggaggcatctcgcaaagccgcagagagtcaagcaagtcaagtaaatcaagcacctaaa
gtactgcctacaccttctactaaaattggtttcaatccaaaccaacaaacaccaactaga
ccaggaccaggacaaagtgttcttgggaaaacttcgtggttgagtagtgcaagtaagcct
tcgaatttggcacacactccctcacatccgaaacctttggagatggctaaagctggtagc
gaggatacagaagatgaagacgagtgggatgatctgcacggtgatgagatattcagaggt
agatctgataacatgctcacgagaaagaaggagtcacctgtgaaaaattctcaacaccac
cccgatgcgatacaacaagacgcacaccaagctgagatttcgattgaggagaaaattaag
aagaacggcaatgcgcatatatttatcgataaatcaagtctacctgtgcattcagtggat
gtagtagatgttcgtgcatttttcggacagttcaaggtatcagatgtactaaaaaacgac
gatggatggttcgtcctgttcacaaaacctggtatagcaggacgcgctatgactacctcc
gatggcaaacagtgttctggatttacaatgcatttgcagctgcgcgatccacgagctcag
cagctcgagacgctcaatgatatcaataaggacaaggtgaagctgtcggataagcgaaca
ttctccgaggagccacatgattcacacgatatggacgatatggacgtggttctcaaatta
aatcgtcccctccagtctcaaaagtcgaaacgtggtcgggttatgaaatcgaaaaacaaa
cacatggtcgatttcaccagcagcgaaggtgaaagtggagatgagaagcagtctactgtt
gtagaaaaggagcctgcttttgagcgttttgaatttgctgagggtgttgacggtattagg
aaaaatgtcgctgatgtcgcttatgacggcagagacgatcgagcacacgtcaacggtcat
gtcaagcgcgattttgatactgtcaatcaacataataatgttgaaattgccgctaaggac
aatcagaatgatgcttctacttttgtcgataatctaaacaatgctgaagctggtttcatt
ggcaaccagagcatctatgaaattaagactacaaacaaacccgctgatatgatcaagacc
gaatcagagcaaacaacctcgactgataacgcaccggataataagtttaggagtaaaaag
gcttccaaggccaagaaagttcctgtttctaagagaaagacgagtaaggcaaccaagaag
tctagcaaaaatgcactcaaaactccaccaccggctgcatcatcagccaagtcagaagaa
tctgcacagtctgacatctccgaagaggcggatgatcctcatcatctatatacacctaag
aacacgatacctacacctcccctaaatgtacctccatttgacccaatctctgatccaagc
cggccctacaccaagaccgacatactatcaagcgacctcgtcaactccgaagaagatctt
tactacctaaaaactgttattgaccgagaagctaggaagttaccaacgaccatccaagaa
ttgctgcaatgtcacaattacacacctccagactggaaggacgatttacgattctcgatt
ttcaatagccctgaaaagactgatgaaaatgcgccatggcggccgcctgtgcatgcaaca
ggaagtgcgagatcggaaggaatttatcccatacccgaaacagagaaggcgttctatctt
ccgcagagaaataaagttaccaaggcatccaggcagcatggggatagagataatgttagt
tcgcgcgccaacagatcaaacgctcgctctctcgttcatggtcttacgggtggtgctacg
gatggtgaaatactcaaattcaaccagcttcgcacacgtaagaaagagctcaaatttgcc
aagtcaagtatacatagctggggtctttacagctgccaagtcataccgaaaggtgaaatg
gtgattgagtatgtcggtgaagtggtcagacagcaggtcgcggataggagagagaaggca
tacgagaagcagggtataggtagctcgtatttgtttaagatcgacgatgacaatattgtt
gatgctacaatgaaaggtagcgtggcacgtctaattaatcactgctgccagccaaactgt
actgctaaaatcatcaccattctcggagagaagaagataatcatctatgccaaggaggag
atttcaccaggggatgagatcacatatgactaccacttccctattgaggatgagaagatt
ccgtgtctctgtggtgtcgatggttgtagaggatcgcttaattga

DBGET integrated database retrieval system