KEGG   Wallemia ichthyophaga: J056_000614Help
Entry
J056_000614       CDS       T03457                                 

Definition
(RefSeq) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00250  Alanine, aspartate and glutamate metabolism
wic00410  beta-Alanine metabolism
wic00430  Taurine and hypotaurine metabolism
wic00650  Butanoate metabolism
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
Module
wic_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    J056_000614
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    J056_000614
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    J056_000614
   00430 Taurine and hypotaurine metabolism
    J056_000614
Enzymes [BR:wic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     J056_000614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC OKR_DC_1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 20373566
NCBI-ProteinID: XP_009268517
UniProt: R9AF17
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MPLSKHINTEKLISDSRDDARSLVERASGEEARKYTSRRYGQAPLPKYEFPSTGVDDNVA
YQLIHDELNGDSTPFLNLASFVTTRMSSLGQKLVDENINKNIADQDQYKSSFELQNRVIS
MMSDLWKVPKDGSCSAVGTVTAGSSEGLLMGVLALKKLWQGKVIAENAALESAQANSQNV
SNTTPATQKHKTPRSFKEPGGNMIFASSAHCCVEKAARYFDLEARIVPIGEKSSEKGEGS
RYTLDPEAIPDLVDENTIGVVVIAGSTYTGHIEDVIGVNKVLDRVQKERGFDIPIHVDAA
SGGFVLPFAFPKHKWAFDVPRVHSINSSGHKYGGTYVGSGIVIWKDEKLLPKELVFEMHY
LGSTELSFTLNFSRPAAPVIAQYYNFINLGYEGYCSILQNDFSNARILARALEKSGYFEV
LSDNHRLDPNSDVKDNQLAEAYAPSLPVVAFRWTDKFREEHPYLEQKWVQILMKTKGWIL
PNYGMSENLTSVEIIRAVMREEMSEDMLDILVKDLIEVQEALTDDSSDFYKLALTSSGKK
PSTKQPSEDTREEKKEDDAHQGYSRPC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcctttatcaaagcacatcaacactgagaaactcatttctgattcacgcgatgacgcc
agaagcctcgtagaaagggcatccggtgaagaagctcgaaagtacacctctagaagatac
ggtcaagcgcctcttcctaagtacgaattcccctctaccggtgtcgatgataatgtcgcg
taccagctcattcacgacgagctaaatggtgacagtacaccattcctcaatctcgcgtca
ttcgtcaccactcgaatgtcctctttggggcaaaagttggttgatgaaaatatcaacaag
aacattgcagaccaggaccaatacaagtcttcatttgagctgcagaaccgtgttataagc
atgatgtcagacctatggaaagttccaaaggacggctcctgctcagctgtcggtaccgtg
accgctggatcaagtgaagggcttcttatgggcgttttggctttgaaaaagctctggcaa
ggcaaagtaatagcagagaatgctgcgcttgaatctgcgcaagcaaatagtcaaaatgtc
tcaaatacgacacctgctacacaaaagcataaaaccccacgcagcttcaaagaaccaggt
ggaaatatgattttcgcgtcatctgctcattgctgcgtagagaaggctgccagatatttc
gacttggaagcgagaatcgtcccaataggcgaaaaaagctctgaaaaaggtgaaggtagc
cgttacactcttgatcccgaagcaattccggaccttgtggatgagaataccatcggagtg
gtagtcatcgcaggcagtacatatacaggccacattgaggacgtcattggtgtgaacaaa
gtgttagatagagtccaaaaagagcgtggattcgacattcctatccacgtagatgctgcc
tcaggtggattcgtcctgccatttgctttccctaagcacaagtgggcatttgacgtacct
cgcgttcactccataaacagctcaggtcataaatacggtggtacatacgttggctcaggt
atcgtcatctggaaagacgagaagctcttaccgaaggagctcgtattcgaaatgcactat
cttggttcaactgagctttcattcacgctcaatttctcgcgtccagcagctccagtgatt
gcgcaatactacaactttattaatctaggctatgaaggttactgttcgatcttgcaaaat
gacttttctaatgcgcgtattctcgcacgtgccctcgaaaaaagcggctacttcgaggtg
ctatctgacaatcatcgcctcgatcccaacagcgatgtcaaggataaccagctcgctgaa
gcatacgcaccttctctcccagtcgttgcctttagatggaccgacaagttcagagaagaa
cacccttacctcgagcagaaatgggtgcaaattttgatgaagacaaagggttggatcttg
ccaaattatggaatgagtgagaacttgacatctgtagagattatcagagcagtaatgaga
gaggagatgagtgaagacatgctagacatcctcgtgaaggacctcattgaagtgcaagaa
gcgctcacggacgacagctctgacttttataaactcgctctcaccagctcgggcaaaaag
ccatctacaaagcaaccctctgaagatacacgtgaggaaaagaaagaagatgatgctcac
caaggctactcgcgtccatgctaa

DBGET integrated database retrieval system