KEGG   Wallemia ichthyophaga: J056_000811Help
Entry
J056_000811       CDS       T03457                                 

Definition
(RefSeq) Glutathione S-transferase 1
Organism
wic  Wallemia ichthyophaga
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 20373763
NCBI-ProteinID: XP_009268714
UniProt: R9AEL2
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MAPAITLYACASGPNPPKVAYLLEELGISYDIKSLVFGEGDENKPGVKGASFLKINPNGR
VPAIVDHENNDFCVWESGAILQYLAETKKGGDKYIGGGHGNEKYEVLTWLAFQISGHGPM
QGQVNYTKLFFKNYWNEECQPSVVKRFENETYRVFSVLESRLKAQKQAGSDYIAGKNYSI
ADMSFHAWLRIAAFPGLDLSGYPTLKAYMEHMEAKQSTQAATKKIADACK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagcaattactctttacgcatgcgcttctggccctaaccctccaaaggttgca
tacctcctcgaagagttgggcattagctacgatatcaaatcgctcgtattcggcgagggt
gatgagaacaaaccgggcgtgaagggtgcgtcattccttaaaatcaatccaaacggccga
gttccagccatcgtcgaccacgagaacaacgacttctgcgtctgggagagtggcgcgatc
ctgcaatacctcgctgagacgaagaagggaggcgataagtacattggcggtggccatgga
aacgagaagtacgaggtactcacatggctcgcattccaaatctccggccatggccctatg
caaggacaagtgaactacacgaagctcttcttcaagaattactggaacgaggagtgtcag
ccatctgtggtaaagcgttttgagaacgagacttatcgtgtgtttagcgtgctggagagt
agactcaaggcacagaagcaggcgggaagcgattacatcgccggtaagaactactcgatc
gccgatatgtccttccacgcttggttgcgtattgctgcgttcccaggcctcgatctgagt
ggatacccaactctcaaggcatacatggagcacatggaggctaagcagagcacccaagct
gccaccaagaagatcgctgatgcttgcaagtaa

DBGET integrated database retrieval system