KEGG   Wallemia ichthyophaga: J056_002098Help
Entry
J056_002098       CDS       T03457                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00020  Citrate cycle (TCA cycle)
wic00190  Oxidative phosphorylation
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
wic01130  Biosynthesis of antibiotics
wic01200  Carbon metabolism
Module
wic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wic_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J056_002098
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J056_002098
Enzymes [BR:wic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J056_002098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Nucleoporin_FG2
Motif
Other DBs
NCBI-GeneID: 20375050
NCBI-ProteinID: XP_009266237
UniProt: R9APP0
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MLRLRNIRGSPLSRRAFSTSAVVSRVVATDPVKAKHAENNGFAASNYPVIDHEYDAVVVG
AGGSGLRAAFGLAEAGHKTACITKLFPTRSHTVAAQGGINAALGNMTKDDWRWHMYDTVK
GSDWLGDQDAIHYMCREAPRTVVELEHYGVPFSRTADGKIYQRAFGGQSLEYGKGGQAYR
CAAAADRTGHALLHTLYGQSLRHDTNFFIEYFALDLIMEDGECVGVMALNMEDGTLHRFR
SHNTVLATGGYGRSYFSCTSAHTCTGDGNAMVSRAGLPLQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHCYLQL
SHLPPDVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKWTGEVLSIDEQG
KDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIRDNNEAGKPHKKISEN
AGMGSIENLDKVRNSTGPKSTADIRLDMQKVMQSDAAVFRTDQSLQEGVEKMKKVYDSYA
QIGLSDRSMIWNTDLVESLELTNLLQCAMQTIVAAANRKESRGAHAREDFSERDDEKWMK
HTLTFQPDVESNNVDLTYRAVEGETLDESECKSVPPFQRSY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcttagattgagaaatatccgcggctcgccgctttctagacgtgctttctcgacttcg
gccgttgtttcgagagttgtggccaccgacccagtcaaggcgaagcacgcagagaacaat
ggatttgctgcttccaactacccagtaatcgatcatgaatacgatgcagtcgtcgtcggt
gccggcggttctggtcttcgtgccgctttcggtttggcagaggctggccacaagacagct
tgtatcactaagctgttcccaacgcgctcgcatactgtcgctgctcagggcggtatcaac
gctgcacttggcaatatgacaaaggacgactggagatggcacatgtacgatactgtcaaa
ggctctgattggctcggtgaccaagacgcaatccattacatgtgtcgtgaagcgccacgc
accgtcgtcgagctggagcactacggtgttcctttctctcgtaccgccgatggaaaaatc
taccagcgtgcatttggtggtcaatcacttgagtacggtaagggtggccaggcgtacagg
tgtgcagctgctgcagaccgtactgggcacgctctcttgcacacgctctacggtcaatca
cttcgccacgacacaaacttcttcatcgaatattttgcactcgacttgatcatggaagat
ggcgagtgtgtcggtgtaatggcgctcaatatggaggatggcactctgcatcgtttcaga
tcacacaacacggttctcgctaccggtggttacggtcgctcatacttctcgtgcacctct
gcacacacctgcacaggtgatggtaatgcgatggtttctagagctggcttgccgctccag
gatcttgagtttgtgcagttccaccctactggtatttatggtgcgggctgtctcatcacg
gagggatcacgtggtgagggtggttaccttctcaactctgagggtgaaagattcatggaa
cgttacgcaccaactgcaaaagatttggcttcacgtgatgtcgtctctcgttcgatgacg
atagaaatacgtgaaggaagaggtgtgggtccggagaaggaccactgttacctccaactg
tctcacttgccacctgatgtgttgcacgagcgacttccaggtatttcagagacagcagcc
atcttctctggtgtagatgtcaccaaagagccaatcccagtattgccaacggtgcactac
aacatgggtggtataccaacgaaatggacaggagaggttttgtcaatcgatgagcaaggc
aaggacaaggtggtacctggattgtatgcggcaggagaagcagcttgtgtatctgtccac
ggagccaacagattgggagccaactcactccttgatatcgttgtgttcggtagggcgtgc
gctaaccacattcgtgacaacaacgaagctggaaagccacacaagaagattagcgaaaat
gccgggatgggtagtatagagaatcttgacaaggtgcgcaactctactggtccaaaatct
acagcggatatacgtcttgatatgcagaaggttatgcaatcagacgcagctgtattcaga
accgatcagagtttgcaagagggagtggagaagatgaagaaggtttacgactcgtatgct
caaattggattgagcgatagaagcatgatatggaacacagacttggtggagagcctcgaa
ttgacaaatttgctccagtgcgctatgcagactatcgtggctgctgctaatcgtaaagag
agccgtggtgctcatgcaagagaggactttagcgagcgcgatgatgaaaagtggatgaaa
cacacactcacattccagccagacgtagagagcaataacgttgatcttacgtacagggct
gttgagggcgagacgctggatgaaagtgagtgcaagtcggtaccgccattccagcgttca
tactag

DBGET integrated database retrieval system