KEGG   Wallemia ichthyophaga: J056_002817Help
Entry
J056_002817       CDS       T03457                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00564  Glycerophospholipid metabolism
wic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    J056_002817
Enzymes [BR:wic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     J056_002817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox FAD_binding_3 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 20375769
NCBI-ProteinID: XP_009270357
UniProt: R9AFH3
LinkDB All DBs
Position
Unknown
AA seq 766 aa AA seqDB search
MFRRASSRLLSRNGLVGSTAALGLTSYAYLNSNKESISMDDSIDRRPSALWTPPSREHML
TKLGAFDSKDKEEIWDLLIVGGGATGAGVAVDAATRGYKTALVERDDFSSGTSSKSTKLV
HGGVRYLQKAILELDYEQWKLVREALHERKTFLDIAPYLSQPLPIMLPVYTWWQLPYFFV
GCKVYDFLAGSQNMESSYAMFKSKTVESFPMLKSDGLVGSVVYYDGQHNDARMNMALIMT
AVHHGATVANHTEVVRLEKNSSGKIEGARLRDNITKHEWDVKSKGIINATGPFSDGIRKF
DEPQVQEIVAPSSGVHITLPSYYCSPELGLIDPNTSDGRVIFFLPWLGNVIAGTTDSPSK
VERNPAPKEEEIQWIIDEVRRYLSPDLKVRRGDVLSAWSGLRPLVRDPAAKNTQSLVRNH
MINISKGGLLTIAGGKWTTYRSMAEETVDAAIKEFDLEPRKCQTTKVKLVGSHGWTPMMF
IKLIQQFGLETDVAKHLAATYGSLAWNVAAMTEATGLRWPIHGTRLATTYPFLESEVRYA
CRAEYAQTSTDVIARRTRLSFLNAQASLEALPRVVDIMAEELGWDLSRKQQEFDQGKDYL
MTMGLPPTKQNLSLGDVRSGKVVDNDSAEIEDAVFARAQFSPTELESLKEKFAALDLDHD
GSISNEDLGKSLNNLGYKNVSEDAVASILQEVQHKDGVTLDSFLDIASGLKEVELSTAFT
SVLSQVPSSLQEHVGQTYGGPKGGSNVGIGAAADASSGSEKSGGGV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagagcgtcatcaagactcttatccaggaatggcctcgttggctcaaccgca
gcgctcggattgaccagctacgcctatttgaactcgaacaaggaatccatcagcatggat
gactcaattgatcgtcgcccatctgctctctggactccaccttcccgtgagcacatgctc
accaaattaggcgcgttcgattcaaaggacaaggaagaaatctgggatcttctcatcgtc
ggtggtggtgccactggtgctggtgttgcagttgacgctgctacaagaggctacaagact
gcgctcgtagagcgtgacgacttctcttctggtacctcttcaaaatcaactaagctcgtc
cacggcggtgtgagatacctccaaaaagctatccttgaacttgattatgagcaatggaag
ctcgtccgtgaagccctccacgaacgtaagacgttcttggatatcgctccttacctctca
caaccactcccaattatgctacctgtttacacctggtggcaactcccttacttcttcgtc
ggttgtaaggtgtacgatttcctcgcaggatcacaaaacatggaatcctcatacgctatg
ttcaagagcaagacagttgaatccttcccaatgctcaagtctgacggtctcgttggttcc
gttgtatactacgacggtcaacacaatgacgcccgtatgaacatggccttgattatgacc
gccgtccaccacggtgctacagtcgccaaccacaccgaagttgtccgtcttgaaaagaat
tcaagcggcaagattgagggtgctagactgagggacaacatcaccaagcacgaatgggat
gtaaagtcaaagggtatcatcaacgctaccgggccattctcagacggtattcgtaaattc
gatgaacctcaagtccaagaaattgttgctccatcatccggtgttcacattacactccca
tcatactactgctcaccagagcttggtttgatcgatccaaacacctccgacggccgtgtc
attttcttcttgccatggttaggtaacgtcattgctggtactaccgactctccatccaag
gttgagcgcaacccagctccaaaggaggaagaaatccaatggatcatcgatgaggtccgt
agatatctctcaccagacctcaaggtccgtcgtggtgacgttctctcagcatggtcaggt
ctcagaccactcgttcgcgacccagcagctaagaacacacaatctcttgtcagaaaccac
atgatcaacatttcaaagggtggtcttttgaccattgctggtggtaagtggactacctac
cgttccatggccgaagaaacagtcgacgctgctatcaaggagttcgatctcgagccaaga
aagtgtcaaaccaccaaggttaagcttgtaggatcacacggctggactcctatgatgttt
atcaagcttatccaacaattcggtttggagactgacgtagctaagcatttggctgccacc
tacggttctttagcatggaacgttgccgccatgactgaagcaactggattaagatggcca
atccacggtacaagactcgcaaccacatacccattccttgaatctgaagttagatacgct
tgccgtgcagaatacgcacaaacctcaaccgacgttatcgcacgtagaactagactttca
ttcctcaacgcccaagcctccctcgaggctcttccaagagttgtcgacattatggctgaa
gaacttggatgggatttgagccgtaagcagcaagaattcgatcaaggtaaagactacctg
atgacaatgggtcttccaccaaccaagcaaaacctctcattgggcgatgtcagaagcggt
aaggttgtcgacaatgactcagcagagattgaagacgctgtgtttgctagagctcaattc
tcaccaactgaattggaatccctcaaggagaaattcgctgcattggatctcgatcacgat
ggatctatctctaatgaagatcttggcaagtcactcaacaacctcggttacaagaatgtc
tcagaagatgccgtcgcatctatccttcaagaagttcaacacaaggatggtgtcacattg
gattcattcttggacattgcatccggattaaaggaagttgagttgtctactgctttcacc
agcgttctgagccaagttccaagctcgttacaagaacacgtcggtcaaacctacggtggt
ccaaagggtggtagcaacgttggtattggcgcagctgcagatgcaagctctggctctgag
aagtctggcggtggtgtctaa

DBGET integrated database retrieval system