KEGG   Wallemia ichthyophaga: J056_003851Help
Entry
J056_003851       CDS       T03457                                 

Definition
(RefSeq) Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase cnrN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00562  Inositol phosphate metabolism
wic01100  Metabolic pathways
wic04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    J056_003851
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    J056_003851
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:wic01009]
    J056_003851
Enzymes [BR:wic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     J056_003851
    3.1.3.48  protein-tyrosine-phosphatase
     J056_003851
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     J056_003851
Protein phosphatases and associated proteins [BR:wic01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    J056_003851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase3 DSPc PTPlike_phytase Y_phosphatase CDKN3
Motif
Other DBs
NCBI-GeneID: 20376803
NCBI-ProteinID: XP_009267335
UniProt: R9AHK5
LinkDB All DBs
Position
Unknown
AA seq 401 aa AA seqDB search
MAQMTKYIQRVASGPKQRFRDPETDTDLDLSYISDNIIIMGYPTPANNYQAVFRNNQDQV
RKLLESRHGRNWRIYNLCPCHENKYDPAYFYNQVVRYPFPDHHAPPLALIKVAVKNMGRY
LSENAENVVVVHCKAGKGRSGTIACCLLLTLAELPPPSRHVSNRPRHSYYPSGNEIDADQ
SRPSQLKTHQGHAKSDASAVQRLVEPHIIPSAASSTSHLTTTEATENSNSTLPPALERAE
DVLKLHTHRRMKTKESNKTKEKDVSRWRMGVSIPSQRRFIEYFARELANEVVHNSHNVRV
WRVTVRLSENFGKLAKTIVGLGNTRLCLHFARYTDDYVEALQDGVNNDDESFSIQDDRWD
KEKMVHRFAETDEYTTEEDDQVGHQNLNLYARSNPQLQPRM
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatgacgaaatatattcaacgcgtcgctagcggaccaaagcaaagattccga
gatccagaaacggatacagatttagatctatcgtacatatctgacaatatcatcataatg
ggttaccctacacctgcgaacaattatcaggcggtatttcgcaataaccaggaccaagtg
agaaagctgcttgaaagtagacacggacgtaattggaggatatacaatctgtgtccgtgc
cacgagaataagtatgatccagcctatttctacaatcaagtggtaagatatccattccca
gatcaccatgcaccccctcttgcattgataaaggttgctgtgaagaatatggggagatat
ctgagcgagaacgcggagaatgttgtagtagtacactgcaaagccggtaaagggagaagt
gggacgattgcatgctgtcttctgctcacattggctgagctgccaccgccaagtcgacat
gtatccaacaggccaagacactcttactacccttcaggtaatgagattgatgcggatcaa
tcaagaccttcacaactaaaaactcatcagggacatgctaaaagtgacgcatcagcagta
caaagactagtggaaccccatatcataccctcagcagcgtcgagtacatcacacctaacg
acgacagaagcgacagaaaactcaaactcaaccctaccacctgctttagagagagcagaa
gatgttctaaagctgcacacacaccgtcgtatgaaaactaaggaaagtaataaaactaag
gagaaggacgtgtctagatggcggatgggtgtaagcataccgtctcaaaggcgattcatt
gaatattttgcgagggagttagcaaatgaggttgtacacaacagtcacaatgtcagagta
tggagggtgacagttcggctgagtgaaaattttggaaaacttgctaaaacgatcgtgggt
ctcggtaatacccgtctctgcctacattttgctaggtatacagatgattatgtggaagcg
ttacaagacggtgtaaataatgatgatgaatctttttcgatccaagatgacagatgggac
aaagagaagatggttcataggtttgcagagacggacgaatatacgactgaagaggatgat
caagtagggcatcaaaaccttaacctttacgccagaagtaatcctcaactccagccgaga
atgtag

DBGET integrated database retrieval system