KEGG   Wallemia ichthyophaga: J056_004017Help
Entry
J056_004017       CDS       T03457                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00020  Citrate cycle (TCA cycle)
wic00310  Lysine degradation
wic00380  Tryptophan metabolism
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
wic01130  Biosynthesis of antibiotics
wic01200  Carbon metabolism
Module
wic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wic00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J056_004017
  Amino acid metabolism
   00310 Lysine degradation
    J056_004017
   00380 Tryptophan metabolism
    J056_004017
Enzymes [BR:wic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     J056_004017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 20376969
NCBI-ProteinID: XP_009267501
UniProt: R9ANX2
LinkDB All DBs
Position
Unknown
AA seq 1019 aa AA seqDB search
MSESLAHRHPSLNDKMIPRVTRLSTRLQARRLPSITQPRLRKLATSVQEDDGFAGANAFY
VEQMYRHWKEDHSSVDESWDVYFNSLDGKPPVPSVSAGAGVGAIKEPPNQAFVNTPLDVP
KTDSNSLTDHLKVQLLVRAFQVRGHILAKTDPLGIVEPERQLNMPSELELTHYGWSESDL
DTKQFDLGPGILKRFTDTGKSRMTLREIYDLCKQIYCGPIGSQYVHIPEKDQCDWIRDRI
ESPQPWNFSLEEKRMVLDRLVWSDSFERFIATKFPNEKRFGLEGCESLIPGMKAIIDRSV
EHGVKSAVIGMPHRGRLNVLANVIRKPGEAIFNEFSPVASADDESGGGDVKYHLGANYVR
PTPSGKKVSLSLVANPSHLEAEDPVVLGKTRALQFFDGDKERLSAMGILLHGDAAFSAQG
VVYETLGFHSTPGYGTGGTIHICINNQIGFTTDPRFSRSTPYPTDVAKFIDAPIFHVNAD
DPEAVVFICQLAADWRAKWKKDIVIDLVCYRRHGHNETDQPAFTQPRMYQAISKKPNILD
IYVDYLQNEGTFTKQDTDEHKKWVWQTLEKSFQNSKEYKPSPKEWLSSSWDGFPTPSELS
QLVLPVNPTGVREDKLVDIAKKLGNLPEGFTVHRNLSRVLKNREKMVEEGKGIDWSTAET
LAMGALATEGNHIRLSGQDVERGTFSQRHSIIHDQKTGEAFMPLNHLGEKQAPVTIVNST
LSEFGVLGFELGYSLVSPDSLTIWEAQFGDFANNAQCMIDQFISSGERKWLQRTGLVLSL
PHGYDGQGPEHSSGRIERFLQLCDDNPLIFPSEEQQIRQHQDCNMQVVYPTTPANYFHVL
RRQVHRGFRKPLVLFFAKSLLRHPMARSDLSELSGDTSFQRYLPDPHPDHLVAPEQVRRH
ILCSGQVYHTLIKHRDEKGIKDVVISRLEQLSPFPYDMIKPNLDKYPNADLYWCQEEPVN
NGAWSYVSQRLITLVDNTEHHKGKVPLYAGRPPSSSVATGSKASHKSEIENFLNDAFKE
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcacttgcgcatcgacatccatcacttaacgataaaatgatcccgcgtgtg
acgagattgtctacgcgtctgcaagcaagacgcttaccaagcattacacagcccaggctg
cgcaaattggccacttcggtgcaagaggatgacggattcgctggtgcaaacgccttctac
gttgagcagatgtacaggcattggaaggaagaccactcctctgttgacgagagctgggat
gtgtacttcaacagcttggatggaaaacctcccgttccttcagtatctgccggtgcaggc
gtaggtgcgatcaaggagccaccaaaccaagcattcgtcaatactccattagatgttcca
aagactgactcaaatagcctgactgatcacctcaaagttcagcttttggttagagctttc
caagtccgtggccacatactcgcaaagactgatccactcggtatcgttgagcctgaaaga
caattgaacatgccatcagagttggagcttacccactacggttggtctgaatctgatctc
gataccaagcaattcgacctcggtccaggtattcttaagcgcttcactgacactggaaag
tccagaatgaccctgcgtgaaatttacgacctctgcaagcagatttactgtggtcccatt
ggttctcaatacgttcacataccagaaaaggaccaatgcgattggattagagacagaata
gaatccccacagccttggaacttttccttggaagaaaagagaatggttttggatagactc
gtttggtctgattctttcgaacgtttcatcgctaccaagttccctaatgaaaaaagattc
ggtttggagggttgtgaatcacttattcctggtatgaaagcaattattgatcgctctgtt
gagcacggtgtcaagtctgccgtgattggtatgccacatcgtggtcgtttgaacgttctc
gccaacgttattcgtaagccaggtgaagctattttcaacgagttctccccagtggcatca
gctgacgatgaatctggcggtggtgacgttaagtaccacttaggtgcaaactacgttcgt
ccaacaccatcgggcaaaaaggtttcgctctcacttgttgccaacccatctcacttggag
gctgaagatcctgttgtcttgggtaagacccgcgcattgcaattcttcgatggtgataaa
gaaagactctctgctatgggcattcttctccatggtgatgctgcattctccgctcaaggt
gttgtttatgagactctcggtttccactctaccccaggatatggtactggtggtacgatt
cacatctgtataaacaaccaaatcggtttcaccactgacccaagattctcacgctcaaca
ccttacccaactgatgttgccaaattcattgatgcaccaatcttccacgtcaacgctgat
gatccagaggcagtcgttttcatttgtcaattagcagcagactggcgtgccaagtggaag
aaggatattgttatcgacttggtttgctaccgtcgtcacggtcacaacgagactgatcaa
cctgctttcacacaaccacgtatgtatcaagctatttctaagaaaccaaacatcctcgac
atttacgtcgattatcttcaaaatgagggtacatttactaagcaagacacggatgagcac
aagaaatgggtgtggcagactcttgagaagtcattccagaactcaaaggaatacaagcca
agtccgaaagaatggctttcatcgtcttgggatggattcccaacaccttcagagctttca
caacttgttcttccagtaaatccaactggtgttcgtgaggataagctggttgatattgct
aagaagcttggcaacttgccagaaggtttcactgtacatcgcaacttgagccgtgtgctt
aagaacagagagaagatggttgaagagggcaagggtattgactggtcaacagctgaaaca
ctcgcgatgggtgcactggctacagagggtaaccacatcagattatcaggtcaggatgtc
gagagaggtacattctcgcaacgtcactctattatccacgatcaaaagacgggtgaagcc
ttcatgccattgaaccaccttggtgagaagcaagcaccggtcactatagttaactcaaca
ttgtctgaatttggtgttcttgggtttgagctcggatactcgcttgtctctccagattct
cttaccatttgggaggcgcagtttggagatttcgctaacaatgcacaatgtatgattgat
cagttcatttcatcaggagagaggaagtggttacagcgcacaggtttagtactctcactt
ccacatggatatgatggacaaggaccggagcattcaagtggtagaatagagcgtttcctg
cagctctgcgacgataatccacttatattcccaagtgaagagcaacaaatcagacagcat
caagattgtaatatgcaggtagtgtatccaacgacgccagctaattacttccacgtcctt
cgtcgtcaagtgcatcgtggattccgtaagccattggtgttgttcttcgccaagagctta
ttgcgtcacccaatggctagatcggacttgagtgagttgagcggtgatacaagtttccaa
cgttacttgccagacccacatccagatcatctggttgcacctgagcaagtgcgtcgtcac
atactgtgttctggacaagtttatcacacgttaataaaacaccgtgatgagaagggaata
aaggatgtggtaatctcacgtcttgaacagttatcaccattcccatatgacatgattaag
ccaaacttggataagtatccaaatgctgatttatactggtgtcaagaagaaccagtgaat
aatggagcgtggtcatatgtgtcgcaacgacttattacgctggttgacaacactgaacat
cacaaaggtaaggtaccattatatgcgggtagaccaccatcatcttcagttgcaactgga
tccaaggcatcgcataagtctgaaatagagaatttcttgaatgatgctttcaaggagtga

DBGET integrated database retrieval system