KEGG   Wallemia ichthyophaga: J056_004190Help
Entry
J056_004190       CDS       T03457                                 

Definition
(RefSeq) Alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00052  Galactose metabolism
wic00500  Starch and sucrose metabolism
wic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    J056_004190
   00500 Starch and sucrose metabolism
    J056_004190
Enzymes [BR:wic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     J056_004190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 NDUFB11
Motif
Other DBs
NCBI-GeneID: 20377142
NCBI-ProteinID: XP_009267666
UniProt: R9AGP7
LinkDB All DBs
Position
Unknown
AA seq 946 aa AA seqDB search
MKLKLATAAFVSAAVALTPLSSEDYTSKIKDCPGYAVDSAQTEHTTNGLKAHLQLAGDAC
NAFGEDVQNLTLEATYETKERLHVKIYDQEEKHFQVPEDIFERPQFEENEALKNSSDLQF
DYTEAPFAFWITRRSNGQVLFDTRLSEIPSYSEPFDANDTSASVSVMPNHNLIFEPQYIQ
LSSALPQQANIYGLGEAVTPHYRRNSSYTRQTNWSNDEGTPRNTNIYGSHPFYIENRVKD
GKSFNHGVLLLSSNGLETWLRDGVFQQRIIGGVLDYYFLSGGEGENKPADVIRNYSEVVG
KPYLPPYWTLGFHMTRWGYENDSDFESILNDMRDAGIPQESAFMDIDFMLAYRDWTVDQN
RFSRLREIVDKLHERGQKFVPIHDNAIPITRNESDAYDFYTSGHEQDVFIKNQNGTEYIG
QVWPGYTVFPDPYAENATKWWTESFQKFHDEIPFDSIWLDMTEPASFNSGSLNGMGPLAQ
YQPSEVTSWPEGYNNTISGNSGNITIDGDLTYKQQSQQSPSRRQMLSRRMGTLETVDNDL
EKLTFPPYQIHLGTPEEFFTLGHDTVSANATHENGFDEYDVHNLNGHMVAKMTRDALDTI
YGGNRSMIIARSNFVGMGTFSQHWLGDNYSTWMSMRDSIKGLFQFSAFQMPFVGADACGF
GGNTDEELCTRWMMLASLTPFYRNHNTHGAIPQEPYRWDSTANATKTAINTRYQLLPYMY
STLYKQSVDGTPVMRPLFYEFPTHSELLDWDDQFLVGDHLLVSPALFPNVTQVDAYFPGD
EPYYDWYSHQKVNVTDEHSSVTLDAGLTDLNVHLRGGAFMLLHSEPGMTVTETTETPFNA
LVTLSKDKKAEGQYYFDDGFSQFNETVTCVMFNVSAEGMQSRVEMNNYDIGQPLNRVDII
GWDGEPPKSVMNGDAQVEFNYDADSQTLSLHSLNHMLNESMDITFD
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaactcgcaacagccgcgtttgtctcagccgcggtggcacttactccacta
tcgtctgaagactacacaagtaaaattaaagactgtcccggatatgcggtcgacagtgct
caaactgaacatactacaaacggtctcaaggcgcacctccagctggccggtgacgcatgc
aacgcttttggtgaagatgtacagaacctcaccttagaggcgacatatgagactaaagag
cgtctacacgtcaagatatacgatcaggaagagaaacatttccaagtccctgaagatatc
tttgagcgtcctcaatttgaggaaaatgaggcgctgaagaacagctctgatttgcagttc
gactacacagaagcaccattcgctttctggatcactaggagatctaacggccaagtattg
ttcgatacacgcttatcagaaattccatcctacagcgaacctttcgacgcaaatgataca
tcggcaagcgtctcggtgatgcctaaccacaatcttatcttcgagccacaatacatacaa
ctgtcatcggcactccctcaacaggccaacatttatggtcttggtgaggctgtgacacca
cactaccgtcgcaacagctcctacacccgccaaaccaactggtcaaacgacgagggcaca
cctaggaacaccaacatttatggaagtcatccattctacattgaaaatagagtgaaagat
ggcaagtctttcaatcacggtgtattactactctcttcgaatggtcttgagacctggctt
agggatggagtatttcaacagagaatcattggcggtgttttagattactacttcctttca
ggtggtgaaggtgaaaacaaaccagcagacgttattcgcaactactctgaagttgtaggc
aagccatatctcccaccatactggacattaggatttcacatgacgcgttggggatacgag
aatgacagcgactttgaatcaatcttgaacgatatgcgcgatgcagggatcccgcaagag
tcagcattcatggatattgacttcatgctcgcttaccgtgattggacagtcgatcaaaat
cgattcagcagactgagagagattgtcgacaaattgcacgagcgtggtcagaaattcgta
ccgatccacgacaacgctattcctatcacgagaaacgagtcagatgcatatgatttctac
acaagcggccacgagcaggatgtctttattaagaaccagaatggcactgagtacattgga
caagtttggccaggttacactgttttccctgatccatatgccgaaaatgctaccaaatgg
tggacagagtcgttccagaagttccacgatgaaattcctttcgactctatctggcttgat
atgacagagcctgcatctttcaactctgggtctctcaatgggatgggtcctctcgctcaa
taccaaccttcggaagtcacgtcgtggccagagggttataataacactataagtggaaac
agcggaaatattactatcgatggggatctcacatacaagcaacaatcacagcaatcacca
tcgcgtcgccagatgctcagtagacggatgggaacgcttgaaacggtggataatgatctg
gagaagctcacgttcccaccctaccaaatccaccttggaacgccggaagagtttttcacg
ttgggacacgatacggtatctgctaatgcaacgcacgagaatgggtttgacgagtatgat
gtgcacaacctgaacggtcatatggtggcgaagatgacacgtgatgcactcgatactatc
tacggggggaacagatcgatgattatagcgagaagcaactttgttggaatgggtaccttc
tcgcagcactggcttggagataattactcaacgtggatgtctatgcgcgactcaatcaaa
ggattgttccagttcagtgctttccagatgccatttgtgggtgcagacgcgtgtggattc
ggcggcaacacggacgaagagctgtgcacgagatggatgatgctcgcatcgttaacgccg
ttctacaggaaccacaatacacatggcgcgataccgcaggagccatatagatgggactct
acagcgaatgctacaaagactgcaatcaacacgcgctaccaattactaccatatatgtac
agcaccttgtacaaacagtcagtcgatggaacgccagtgatgagaccgcttttctatgaa
ttcccaactcactctgagctactcgattgggatgatcaattcttggtcggcgatcatctt
ctcgtgtcgccagcgctcttccctaacgttacacaagtcgacgcttacttcccgggagat
gaaccatattacgactggtacagccaccagaaagtgaatgtaactgatgagcactcttca
gttacactcgatgctggtttgactgatctcaatgtacacttgcgcggaggcgctttcatg
ctgttgcatagcgagcctggaatgaccgtcacggaaactacagagacgccattcaacgca
ttggtcacactgagcaaggacaagaaagcggaaggacagtactactttgacgacggattc
agtcaattcaacgagacagtcacatgtgtcatgttcaatgtgagtgcagagggaatgcaa
tcgcgcgtcgagatgaacaactacgatatcggtcagccactgaacagggtggatattata
ggctgggatggagagccaccaaagagcgtgatgaatggggatgctcaagtggagttcaat
tacgatgctgatagtcaaacactctcacttcacagcttgaatcacatgctgaacgagtcg
atggacattactttcgattaa

DBGET integrated database retrieval system