KEGG   Wallemia ichthyophaga: J056_004628Help
Entry
J056_004628       CDS       T03457                                 

Definition
(RefSeq) DNA ligase 3
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
wic  Wallemia ichthyophaga
Pathway
wic03030  DNA replication
wic03410  Base excision repair
wic03420  Nucleotide excision repair
wic03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:wic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J056_004628
   03410 Base excision repair
    J056_004628
   03420 Nucleotide excision repair
    J056_004628
   03430 Mismatch repair
    J056_004628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:wic03032]
    J056_004628
   03400 DNA repair and recombination proteins [BR:wic03400]
    J056_004628
Enzymes [BR:wic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     J056_004628
    6.5.1.6  DNA ligase (ATP or NAD+)
     J056_004628
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     J056_004628
DNA replication proteins [BR:wic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    J056_004628
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     J056_004628
DNA repair and recombination proteins [BR:wic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     J056_004628
   NER (nucleotide excision repair)
    Other NER factors
     J056_004628
   MMR (mismatch excision repair)
    Other MMR factors
     J056_004628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 20377580
NCBI-ProteinID: XP_009268098
UniProt: R9AGL2
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MPPADDFDEAIRLSLDSYNDEKREREDYERDLKRVKLDSQQMLRRGGAHAHDHDSVIDSS
HDDAHTAHNLRITQPITFKASPYSFHPPFLSPPIRFDLWTDACVQCSSTRSRIEITNILT
NYFRILIRSDVDSLLPSLWLFSHQLGPPYEPNELGIGGHVLNRSLKDVTSISPSKLRQLH
HKLGDIGDVAFEATRNRISVIEPKPLTVDAVYSTFLSISQQKGPRSQETKTNLVKKLLVS
AKGEQARYLFRSLVQNLRIGAVRTTLSTALARAFAMHYHVSIEESEMAEVVEATGKRARD
GEHTRRVEEKLTGAEKVVRRVYARHPNYNTLVKALRESGLDGLEDSVPVSVGTPVQPMLG
AITRSFDDVLTRLRHRPFTSEAKLDGQRCQLHARVLSASDTLSEEYVCKGWKSSPFDRIG
EQCMVWIRLFSRRLEDMTEKYPDICLSVLEMFKTNPSITSFVVDAEIAAVDDTGRVRPFQ
ELANRSRKAVQMDDVHVKVAVYAFDCMLYNGEPLLDKSFRERRQTLRTNLAPFTFGNCAR
WDHVPSTDDTHLDAITAFFHQCMSMKAEGIMVKLLDYYEEAEGDYGGDHDADEDTKKKSP
SKQKALPATYEPDKRADSWLKVKKDYIAEIGDSMDLVPIGAWHGMGRKNKFWSPILLAVY
DDDEGAFTAVCKCMSGFSDAFYDSLNRVYAEDGPNTSSTPFAGVQVGDLNPDIHFNPFQV
WECRGADITQSPVYPAAKGMVGEKGLSIRFPRFIRCREDKHVEQANTASDLARMYQLQAE
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagctgatgatttcgatgaggctataagactcagtctcgattcctacaacgac
gagaaaagagagagagaggattatgagagggatctcaagcgtgtcaagctcgatagccag
cagatgcttcgtcgcggtggcgctcatgctcatgatcatgattccgtcatcgatagcagc
cacgatgacgcacacacagcacacaacctacgtatcacccaaccaatcactttcaaagca
tctccgtattctttccacccacccttcctttctccccccatcagattcgatctgtggact
gatgcgtgtgttcaatgctcttccactcgctcacgcattgaaatcaccaacatactcact
aactacttccgcattcttattcgcagtgatgttgattccctcctaccctctctctggctc
ttctctcatcaactcggccctccgtatgagcccaacgaactcggcattggcggccacgtt
ctcaaccgctctctcaaggatgtcacctctatttccccctccaaacttcgccagctgcac
cacaaactcggcgatatcggcgacgttgccttcgaagccacccgcaaccgcatctccgtc
atcgagccaaagcccctcactgtcgacgccgtgtactccacttttctctccatttcgcag
cagaaaggaccccggtcccaggaaaccaagaccaatcttgtcaaaaagctccttgtctca
gccaagggtgagcaagcacgctatctgttcaggtcgctagtgcagaatttgcgcattggc
gctgtacgcacgacgctttcgacagcattagcgagggcgttcgcgatgcactaccacgtc
agcattgaggagagcgagatggcagaggtggtggaagcgacaggaaagcgcgcgcgagat
ggcgagcacacgcggcgtgttgaagagaagctcactggtgctgagaaggtggtgaggagg
gtctacgctcgccatcctaattacaacacccttgtgaaagcactgagggagagtggactg
gatgggttggaagattccgtgcctgttagtgttggcacacccgtacagcccatgctcggc
gccatcacccgctcctttgatgacgttctcactcgtcttcgtcacagacctttcacaagc
gaggctaaactggatgggcagagatgtcaattgcatgcgcgtgttctcagcgctagtgat
actctttcggaagaatacgtgtgtaaaggttggaaatcatcgccattcgatagaattggc
gaacagtgcatggtgtggatacgactattctcaagacgactggaagacatgacagaaaag
taccccgatatatgcctgagtgtgttggagatgttcaaaacaaacccctccatcacgtcg
tttgtagtggatgcagaaatcgcagctgtcgacgacacaggcagggtgaggccattccaa
gagctggcaaacaggagcagaaaagcggtgcagatggacgatgtgcatgtcaaagtcgcc
gtgtacgccttcgactgtatgctttacaatggtgagccgctcctcgacaagtcgttcaga
gagcgcagacaaaccctgcgcaccaacctcgcccccttcactttcgggaactgtgcaagg
tgggaccatgtgccctctactgatgacacgcatctcgatgctatcactgctttcttccac
cagtgcatgtcgatgaaggccgagggaataatggtgaagttgctggactactacgaggag
gcggaaggagattacggaggggaccacgatgcagacgaagacacgaaaaagaaatcgcct
tcaaaacagaaagccctgccagctacatacgagcctgacaaacgcgcagacagctggctg
aaagtgaagaaagattacatagccgagataggcgacagcatggatcttgtcccgattggt
gcttggcacggtatggggcgcaagaacaaattctggtcaccgattctactcgctgtgtac
gatgacgatgagggtgctttcactgctgtgtgcaaatgcatgtcaggcttcagcgatgct
ttctacgatagtctcaatcgggtttatgcagaagacggccctaatactagcagcacacct
tttgcgggtgtgcaagtcggagacctcaatccggatattcacttcaaccctttccaagtg
tgggaatgtagaggtgctgatatcacacagtcacccgtatatcccgccgcaaaaggtatg
gtgggggagaagggtcttagcatacgcttcccgcgcttcatccgttgtcgggaggataag
catgtcgagcaggcgaatacggcgagcgatctcgcacgtatgtatcagttgcaggcagag
tga

DBGET integrated database retrieval system