KEGG   Winogradskyella sp. J14-2: BWZ20_04940Help
Entry
BWZ20_04940       CDS       T04714                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
wij  Winogradskyella sp. J14-2
Brite
Translation factors [BR:wij03012]
 Eukaryotic Type
  Elongation factors
   BWZ20_04940
 Prokaryotic Type
   BWZ20_04940
Mitochondrial biogenesis [BR:wij03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BWZ20_04940
Exosome [BR:wij04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BWZ20_04940
  Exosomal proteins of breast cancer cells
   BWZ20_04940
  Exosomal proteins of colorectal cancer cells
   BWZ20_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: APY07684
UniProt: A0A1P8RVK0
LinkDB All DBs
Position
complement(1068474..1069661)
Genome map
AA seq 395 aa AA seqDB search
MAKATFDRSKPHLNIGTIGHVDHGKTTLTAAITKVLADAGLSEARAFDQIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFMNKVDMVDDEELLELVEMEIRDLLSFYEYDGDNGPVIAGSALGALN
GEQKWVDTVMELMEACDSWIEEPVRDMDKPFLMPIEDVFSITGRGTVATGRIETGVANTG
DPVEIIGMGAEKLTSTITGIEMFRQILDRGEAGDNAGILLRGIEKTQISRGMVIVKPGSV
TPHQKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGNISLPDGVEMVMPGDNLTI
TVELIQPIAMNVGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaactttcgatcgttcaaaaccacacttaaatataggtactattggacac
gtagatcacggtaaaacaactttaactgctgctattactaaagtattagctgatgcaggt
ttatctgaagcaagagcattcgatcaaatcgataatgcaccagaagaaaaagaaagaggt
atcacaattaatacttctcacgtagaatatcaaacagcaaaccgtcactacgctcacgtg
gactgtccaggtcacgcggattacgtaaagaacatggttactggtgctgctcaaatggat
ggtgctattttagttgttgctgcaacagatggtccaatgccacaaactcgtgagcatatc
ttacttggtcgtcaggtaggtattcctcgcatcgtagtattcatgaacaaagtggatatg
gttgatgatgaagagttattagaattagtcgagatggaaattagagatttattatctttc
tacgagtatgatggtgataatggtcctgtaatcgctggttctgcattaggtgcattaaac
ggtgagcaaaagtgggttgatactgtaatggagcttatggaagcttgcgatagctggatc
gaagagccggtacgtgatatggataagcctttcttaatgccaatcgaagatgtattctca
attactggacgtggtactgtagcaactggtcgtattgaaactggtgtagctaatacaggt
gaccctgttgagattattggtatgggtgctgagaaattaacatctactattactggtatc
gaaatgttccgtcaaatcttagatagaggtgaagctggtgataacgctggtatcttatta
agaggtattgagaaaactcaaatctctagaggtatggtgatcgttaagcctggttctgta
actcctcaccaaaaattcaaagctgaggtttatattcttaagaaagaagagggtgggcgt
cacactccattccacaataattaccgtcctcagttctacgtgcgtacaactgatgtaact
ggaaatatttctcttccagatggtgttgagatggtaatgcctggcgataacttaactata
actgtcgagttaattcaaccaattgcaatgaacgtaggtttacgtttcgctatccgtgaa
ggtggtagaacagttggtgcaggtcaggtaactgaaattttagactaa

DBGET integrated database retrieval system