KEGG   Winogradskyella sp. J14-2: BWZ20_06625Help
Entry
BWZ20_06625       CDS       T04714                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
wij  Winogradskyella sp. J14-2
Pathway
wij00620  Pyruvate metabolism
wij00680  Methane metabolism
wij01100  Metabolic pathways
wij01120  Microbial metabolism in diverse environments
wij01200  Carbon metabolism
Module
wij_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:wij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWZ20_06625
  09102 Energy metabolism
   00680 Methane metabolism
    BWZ20_06625
Enzymes [BR:wij01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BWZ20_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: APY07995
UniProt: A0A1P8RVQ5
LinkDB All DBs
Position
complement(1425728..1428307)
Genome map
AA seq 859 aa AA seqDB search
MHTEPKLARFNQNVLSKYQIYNSIFMTLPFDTLSKTVALLPLFYETCKMGFEEKNDPSTI
VNTFFEKYQSQLSEKEQIDLLFRFIQYIERQVVLFDAVEDAAFSIVNNMEGVGSLRSLKE
NATAQHKKQLLKEYLETFNVRIVLTAHPTQFYPGAVLGIITDLAKAIKTDNLTEISDLLG
QLGKTPFFKDHKPTPYDEAVNLIWYLKNVFYHSFGSIYDYVQQNIFDYEAINNPIVNIGF
WPGGDRDGNPFVTPEITLNVAKKLKESIIKNYIKDVKYLRRRLTFRGIREHIIDINHKLY
NTLLYRENQISLEELKSGLNAIRTRLIEDHQSLYLDQVTSLINKLTLFGYHFASLDIRQD
SRVHDKMFRSLVGELIDNGSELFPKNFFELPEEDQKLHLAAINGSIGDLEFKEELSQDIV
ETIRAMKSIQETNGEIACSRYIISNNQTTMNVLQLFAMLKIVAFNDNLTADVVPLFETVT
DLIAAPKVMEDLYTNPHYRAHLENRNNKQTIMLGFSDGTKDGGYLMANWAIFKAKEALTT
LSRQYDIDVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTIQGQTISSNFGTLDS
SQYNMEQLISSGIMNRLNDKNTEMAPEDKAVMNHLAELSYQAYVDFKGHPKFLSYLEHMS
TLKYYAKTNIGSRPSKRGKSEGLDFNDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDK
DEFEKVQHLYKESRFFRTLIANSMMSLSKSFFDLTRYMADDPEYGEFWKLIYKEYETTKR
LILKLTGFNELMENEPVAKASIAVRESIVLPLLTIQQYALKKMQELKRADKKDLDKIEVF
EKMVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcatacggaaccaaaattagcacgctttaatcaaaatgtgttgtctaaatatcagata
tataatagcatatttatgacgctgccttttgatacattgtctaaaacagtggccttgttg
ccattattctatgaaacttgtaaaatgggttttgaagaaaaaaatgatccttcaaccata
gtaaataccttttttgagaaataccaaagtcagttgagtgaaaaagaacagatagattta
ttgtttcgttttattcaatatatagagcggcaagttgtattgtttgatgctgttgaagac
gctgctttttctattgttaataacatggagggtgttgggtctttaagaagtttaaaagaa
aatgccactgcacaacacaagaaacaacttttaaaggaatatctagaaacctttaacgta
cgtattgttttaacagcgcacccaacacagttttatcctggggcagtcttaggcattatt
acagatttagctaaagctattaaaacagataatttaaccgaaataagtgatctgctaggg
cagttaggaaaaacaccattctttaaagatcacaaaccaactccatatgacgaagcagta
aatttaatctggtatttaaaaaatgtattttaccattcttttggtagtatttacgattat
gtacaacaaaatatttttgattatgaagcgataaataatcccattgtaaacattggtttt
tggccaggaggtgatagagatggaaatccttttgttacaccagaaatcacattaaatgtt
gctaaaaaactaaaggaatctattataaaaaactacatcaaagatgtaaagtaccttaga
aggcgtctaacatttagaggtataagagagcacattatagacataaaccacaagttatac
aatacgctgctttacagggaaaaccaaatctcattagaggagctaaaatctggtttaaat
gcaataagaacgcgattaatcgaagatcatcaatcattgtacttagaccaagtaacctca
ttaattaacaaattaaccttatttggttatcattttgcgagtttggatataagacaagat
agtcgtgtgcatgataaaatgtttagatcattagtaggtgaattgatagacaatggcagt
gaattgtttccaaagaatttctttgaattacctgaggaggaccaaaaattgcatttggcc
gcaattaatggttctataggcgatctagaatttaaagaagaactttctcaagatatcgta
gaaaccattagagctatgaagtctatacaagagactaatggtgaaatagcatgtagtcgt
tacattattagtaataatcaaaccacaatgaatgtgttacagttgtttgctatgctaaaa
attgtagcatttaatgataatttaaccgctgatgtagtgccgctttttgagactgtgact
gatttaattgctgcaccaaaagtaatggaggatttgtacaccaatcctcattaccgcgca
catttagaaaatagaaataacaaacaaaccataatgctagggtttagtgatggtaccaaa
gatggtggttatcttatggctaactgggcaatttttaaggctaaggaagctttaacaacg
ttgtctagacagtatgatatcgatgttattttctttgatggtagaggtgggccacctgcg
cgtggaggcggaaaaacacatcagttttatgcatctttagggccaactattgaggataaa
gaaattcaattgaccattcaagggcagacgattagttctaacttcggaactttagattct
tcacaatacaatatggagcagcttataagttctggtattatgaatcgccttaatgataag
aatactgaaatggctccagaagataaagcggttatgaaccacttagctgagttaagttat
caagcctatgtagattttaaaggacatcctaaatttttgtcttacttagagcatatgagt
acattaaagtattatgctaagacaaatattggtagtcgaccttcaaagcgaggtaagtct
gaagggttagattttaatgatcttagagccatcccttttgtgggttcttggagtcagtta
aaacaaaatgtacctggattctttggtgttggtacagctttaaagcattatgaagataag
gatgagtttgaaaaagttcagcatttgtataaagaatcacgattctttagaaccttaatt
gctaatagtatgatgtctttgtctaagtcgttctttgacttaacgcgttatatggctgat
gatcctgaatatggtgagttctggaaattgatttacaaagaatacgaaacaacaaaacgt
cttattttaaaacttacaggttttaatgaattaatggaaaatgaacctgtagcaaaagct
tcaattgctgttagagaatctatagtgctgcccttgttaacgattcagcaatatgcatta
aagaaaatgcaggaattaaaacgtgctgataaaaaagatcttgataagattgaggttttt
gaaaagatggtaacaagatctttatttggtaatattaatgctagtagaaattctgcttaa

DBGET integrated database retrieval system