KEGG   Winogradskyella sp. J14-2: BWZ20_08260Help
Entry
BWZ20_08260       CDS       T04714                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
wij  Winogradskyella sp. J14-2
Pathway
wij00010  Glycolysis / Gluconeogenesis
wij00053  Ascorbate and aldarate metabolism
wij00071  Fatty acid degradation
wij00280  Valine, leucine and isoleucine degradation
wij00310  Lysine degradation
wij00330  Arginine and proline metabolism
wij00340  Histidine metabolism
wij00380  Tryptophan metabolism
wij00410  beta-Alanine metabolism
wij00561  Glycerolipid metabolism
wij00620  Pyruvate metabolism
wij00625  Chloroalkane and chloroalkene degradation
wij01100  Metabolic pathways
wij01110  Biosynthesis of secondary metabolites
wij01120  Microbial metabolism in diverse environments
wij01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWZ20_08260
   00053 Ascorbate and aldarate metabolism
    BWZ20_08260
   00620 Pyruvate metabolism
    BWZ20_08260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BWZ20_08260
   00561 Glycerolipid metabolism
    BWZ20_08260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWZ20_08260
   00310 Lysine degradation
    BWZ20_08260
   00330 Arginine and proline metabolism
    BWZ20_08260
   00340 Histidine metabolism
    BWZ20_08260
   00380 Tryptophan metabolism
    BWZ20_08260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BWZ20_08260
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BWZ20_08260
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BWZ20_08260
Enzymes [BR:wij01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BWZ20_08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APY08292
UniProt: A0A1P8RWI1
LinkDB All DBs
Position
complement(1799437..1800990)
Genome map
AA seq 517 aa AA seqDB search
MEAIATDFGIREALKQLGVKDVNEGTSTGSNSFGSGELISSYSPTDGQLIGKVSTTTRED
YDKVIKTAQDAFLQFRAMPAPQRGEIVRQFGNRLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSLGIVGIISAFNFPVAVWSWNTAL
AWVCGDVCVWKASEKAPLCAVACQNIIAEVLKENNLPEGISCIINGDYKVGEFMTTDHRI
PLISATGSTRMGRIVGATVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCG
QRCTSTRRLIIHESVYDKVRDAIVGAYKQLTIGNPLDEKNHIGPLIDTDSVNTYLSAIEK
AKAEGGNILVEGGVLEGEGYESGCYVKPAIIEAENDFEIVQTETFAPILYLMKYSGDLEN
AIEMQNGVAQGLSSAIMTNEMKEAEKFLSFAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKIYMRRQTNTINYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaattgctaccgatttcggaataagagaagctttaaaacaattaggtgttaaa
gatgttaacgaaggaacttctacaggctcaaatagctttggaagtggtgagttaatttca
tcttactctccaacagatggacaattaattggtaaagtttctacgacaactagagaagac
tacgataaagttataaagacagctcaagacgcctttttacagtttagagcaatgcctgca
ccgcaaagaggtgaaatagtaagacagtttggtaaccgcttaagagaattaaaagagcca
ttaggtaagttggtgtcttatgaaatgggtaaatctttacaagaaggttacggagaagta
caagaaatgatagacatctgcgattttgcagtaggtttatctagacagttaaacgggcaa
actattccatcggaaagaccaggacacgttatgagagagcagtggcactctttaggtatt
gttggtattatttcagcatttaatttcccagttgcagtttggtcttggaacacagcttta
gcatgggtttgcggtgatgtttgtgtatggaaagcttcagaaaaagcaccactttgtgca
gtagcttgtcaaaatattattgctgaggtattaaaagaaaataatttaccagaaggtatt
tcttgtatcataaacggagattataaagtaggtgagtttatgacaacagatcatagaatt
ccgctaatctctgcaacaggatctacacgtatgggacgtattgttggagctacagttgct
gagcgttttggtaaatctttattagaattaggaggaaacaacgctataattattacacca
actgcagatttaaaagtagttgtacctggtgcagtgtttggtgcagttggtacttgcgga
caacgttgtacaagtacgcgtcgattaatcattcatgagtcagtttacgataaagtaaga
gatgctattgttggcgcatacaagcaattaactattggtaatccattagacgagaaaaac
cacattggtccattaatcgatacagattctgtaaatacgtatttatctgcaatagaaaaa
gcaaaagctgaaggtggcaatatactagttgaaggaggggttttagaaggtgaaggatac
gagtctggttgctacgtgaaaccagcaattattgaagctgaaaatgattttgaaattgta
caaaccgaaacttttgctccaattttatatttaatgaaatattctggagatttagaaaat
gcaatcgaaatgcaaaatggagttgcacaaggattatcgtctgcaatcatgacgaacgaa
atgaaagaagcagaaaaattcttatcctttgcaggaagtgactgcggtattgccaatgta
aatattggtacttctggtgctgagattggtggtgcttttggaggtgaaaaagaaacaggt
ggcggacgtgaatcaggatctgatgcttggaaaatatacatgcgtagacaaaccaatact
attaattattcagacgaattacctttggcacaaggtattaagtttgatctttag

DBGET integrated database retrieval system