KEGG   Winogradskyella sp. J14-2: BWZ20_13815Help
Entry
BWZ20_13815       CDS       T04714                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
wij  Winogradskyella sp. J14-2
Brite
Enzymes [BR:wij01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BWZ20_13815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: APY09312
UniProt: A0A1P8RZF0
LinkDB All DBs
Position
complement(3065492..3066067)
Genome map
AA seq 191 aa AA seqDB search
MKYIKLSVFAIAIVFATACKDNKKEVEETIETEEDNTVKLEKTEMKIKLDPKSGSNATGT
IKFIEENGKVTMMAYLSDLDKGEHAIHIHESADCSSPDGKSTGGHWNPTAQPHGKWGSET
GYHKGDIGNFKVDDDGKGEIKFTTDEWCLTCEDPTKNIIGKAIIVHQGTDDFTSQPSGAA
GSRISCGAIIE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattaaattgagcgtttttgcaattgctatagtttttgctacagcttgtaag
gacaataagaaagaagtagaagaaactattgaaaccgaagaagataatactgtaaaacta
gaaaaaacagaaatgaagattaagttagatcctaagagtggttctaatgcaactggcact
ataaagtttattgaagaaaatggtaaggttactatgatggcctatctttctgatttagat
aaaggtgaacacgccatacatatacacgagtctgctgattgttcatcaccagatggtaaa
tctactggtggacattggaatccgacagcccaaccgcatggtaaatggggatcagaaaca
gggtatcacaaaggagatattgggaactttaaagttgatgacgatggtaaaggagaaatt
aaatttacaacagatgagtggtgcctaacttgcgaagacccaaccaaaaatattattggt
aaagctataatagtacaccaaggaacagatgactttacatcacagccatctggagcagct
ggtagtagaatcagttgcggtgccatcatagagtaa

DBGET integrated database retrieval system