KEGG   Winogradskyella sp. J14-2: BWZ20_14410Help
Entry
BWZ20_14410       CDS       T04714                                 

Definition
(GenBank) D-xylose transporter XylE
  KO
K08138  MFS transporter, SP family, xylose:H+ symportor
Organism
wij  Winogradskyella sp. J14-2
Brite
KEGG Orthology (KO) [BR:wij00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:wij02000]
    BWZ20_14410
Transporters [BR:wij02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    BWZ20_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 ETRAMP
Motif
Other DBs
NCBI-ProteinID: APY09421
UniProt: A0A1P8RZR9
LinkDB All DBs
Position
3216110..3217486
Genome map
AA seq 458 aa AA seqDB search
MNKKTFLLLITAISALGGLLFGYDTGVINGAQFYLSKYFEFDPTMKGLVVSSALWGCFFG
AIIAGPLSIKIGRKWSLIISAILFSVSAWGSGLPEMLPETITVLIVFRIIGGLGIGIASM
NAPMYIAEIAPSNIRGKMVTYYQLAIVVGFFVVFLATYFIGNNLTEAQNIQFGWRRMFWS
ELIPSILFLVLLFLVPKSPRWLALKGDDDAALRILNKVHGEVQAKNEIKEIKESLETNNN
KEKVNYLSKAILIIIIIGTALSMLQQFTGINAVLYYGADIFEKALGFGKEDVLAQQILLA
FVNLVFTFVAMFTVDKYGRKPLLYIGSIGMIVGFLLLGVSLQQNAVGLVSLIGVLVFIAS
FALSMGPVVWVILSEMFPNKMRSVAMSVAVAAQWAANGLVSQTFPMVMESEANNSAPWNG
SMPYFIFIAFILVIIFLTYKFIPETKGKSLEEIEEFWE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagacatttttactgctaattacagcaatttcggcccttggtggtttgcta
tttggttatgatactggtgtaattaatggcgcacaattttatttgagtaagtattttgaa
tttgacccaacaatgaaaggtttagttgtgagcagtgcactttggggttgtttttttggt
gccattattgccggacccttaagtataaaaatagggcgcaagtggtcgttaattatttca
gcgatactattctctgtatcagcttggggttctggactaccagaaatgttgcctgaaact
ataacggtgcttatcgtttttaggattattggtggattgggaattggtatagcttcgatg
aatgcacctatgtacatagccgaaattgcaccaagtaacattagaggaaaaatggtaacg
tactaccaactagctattgtggtaggcttttttgtagtgtttttagctacttattttata
ggtaataacttaaccgaagcacaaaatattcaatttggctggagacgcatgttttggtct
gaacttataccaagtatcctgtttttagtgctcctgtttcttgttcctaagagtccacgt
tggttggcattaaaaggagatgatgatgcagccttgaggattttgaataaagttcatggt
gaagttcaggcaaaaaacgaaattaaagagattaaagaatctttagaaactaataacaac
aaagaaaaagttaattatttatcaaaggcaattcttataattataatcattggtactgca
ctttctatgttacaacagtttacaggaattaatgcggtactatattacggagcagatata
tttgaaaaggctttaggttttggaaaagaggatgtattggctcaacaaatattgttagca
tttgttaatttggtatttacgtttgtggcgatgtttactgttgataaatacggtagaaaa
ccattattgtatattggttctattggtatgattgtagggttcttgttattaggagtttca
ttgcaacaaaatgcagtaggcttggtatctttaattggtgttttagtatttatcgcttct
tttgctttgtccatgggacctgtagtttgggtgatattatcagaaatgttccctaataaa
atgcgaagtgttgccatgtctgtagccgtagcagcacaatgggctgcaaatggtttggta
tcacagacgtttccgatggtaatggaaagtgaggccaacaacagcgcaccttggaatggc
tcaatgccatactttatttttatagcctttattcttgtaattatctttttaacttataag
tttattccagaaaccaaaggaaaatccttggaagagatcgaggaattttgggagtaa

DBGET integrated database retrieval system