KEGG   Winogradskyella sp. PG-2: WPG_1892Help
Entry
WPG_1892          CDS       T03603                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
win  Winogradskyella sp. PG-2
Pathway
win00564  Glycerophospholipid metabolism
win01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:win00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WPG_1892
Enzymes [BR:win01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WPG_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 NAD_binding_8 HI0933_like GIDA Pyr_redox_2 Lycopene_cycl Pyr_redox_3 FAD_binding_3 GMC_oxred_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAO76122
UniProt: A0A024FHC4
LinkDB All DBs
Position
2090035..2091609
Genome map
AA seq 524 aa AA seqDB search
MFNRKAQLEKLKATAQFDIIVIGGGASGLGIAVDASSRGFKVALFESHDFAKGTSSRSTK
LVHGGVRYLAQGNIKLVTEALRERGLLQKNANHLFKRQAFLIPSYTQLNKYFYGIGLIVY
DLLSLRKSIGGSRIISAKKAISRIVNLKKHKLKGGVTYFDGQFDDARLALNLAQTACESG
AIILNHFKVTDMLKDDEGNLTGIAVTNTETDEIIKVKSKVVINATGVFSNKILKLAGRKK
KSLKIVPSQGIHLVLNKSFLDGETALMVPKTSDGRVLFAIPWHNKVVVGTTDTPIKKPSY
EPKPLQEEIDFILENASEYLIKKPNRKDVLSVFSGLRPLVAPEGDKSNTKEISRGHKIIH
SESGLLTIVGGKWTTYREMSEDVVNEAIITHNLPNVKSKTRVLPIHGNLNGTDRKDLDKN
LWFYGSDATALEQLINSEDSYREQIHPNYQFNTGQVIWAARYEMARTVEDVLARRIRLLF
LDAQAAMECAETVAGILQKELGKSDSWKLNQIEEFKNLAQGYLI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatagaaaggcacaattagaaaagcttaaggcgacagctcaatttgatattata
gtcattggtggtggtgccagcggattaggtattgctgtagatgcatcatctcgagggttt
aaagtcgctttgtttgaatctcatgattttgcaaaaggtacatcaagcagaagcacaaag
ttagtgcatggtggagtacgatatttggcacaaggaaatattaaattagttactgaggcc
ttaagagaaagaggtttgcttcaaaaaaatgctaatcacttattcaaaagacaggcattt
ttaataccgagttatacgcagctaaataaatatttttatggaataggattaattgtgtat
gatttattatctttaagaaaatcaatcggtggctcaagaatcatttctgcaaaaaaggct
attagtagaatagtaaatcttaaaaagcataaacttaaaggaggggttacctactttgat
gggcaatttgatgatgccagattagcattgaatttagcgcaaacagcatgcgagtctgga
gctattattctaaatcattttaaagtaactgatatgcttaaagatgatgaaggtaatctc
accggaattgctgtcactaataccgaaacggatgaaatcattaaggtaaaatctaaggta
gttataaatgctactggtgtattttctaataagattttaaaacttgcaggtcgcaaaaaa
aagagtctcaaaatagtacctagtcaaggtattcatttggttctaaataagtcgttcttg
gatggtgaaacggcattaatggtgcctaaaacaagtgatggacgtgttttatttgcgatt
ccttggcataataaagtggtggttggtacaacagatactcctattaaaaagccaagctat
gaacctaaacctttacaggaagaaatagattttattttagaaaatgcttcagaatatctt
ataaaaaaacccaacagaaaagatgtgctatccgttttttcaggattaagacctttggtt
gcaccagaaggtgataagagtaataccaaagaaatttcaagagggcacaaaattatacat
tcagaaagtggattactcaccattgttggtggtaaatggacaacctacagagagatgagt
gaagatgtagttaatgaagctattataactcataatttgcccaatgtaaaatctaaaaca
agagtattaccaattcatgggaatctaaatgggactgatagaaaagatctagataaaaac
ctatggttttatggaagtgatgctaccgcattagagcaactaataaattcagaagatagt
tatagagaacagatccatcctaattatcaatttaatacaggtcaggtgatctgggctgca
agatatgaaatggcaagaactgttgaagatgtgcttgcaagacgaattagattgttgttt
ttagatgcacaagcagctatggaatgtgctgaaacagttgctggtattttacaaaaagaa
ttaggaaaatctgattcgtggaaacttaatcaaatagaagaatttaagaacctagcgcaa
ggctatttaatttaa

DBGET integrated database retrieval system