KEGG   Weissella jogaejeotgali: FOL01_0606Help
Entry
FOL01_0606        CDS       T04632                                 

Definition
(GenBank) Biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
wjo  Weissella jogaejeotgali
Pathway
wjo00061  Fatty acid biosynthesis
wjo00620  Pyruvate metabolism
wjo00640  Propanoate metabolism
wjo01100  Metabolic pathways
wjo01110  Biosynthesis of secondary metabolites
wjo01120  Microbial metabolism in diverse environments
wjo01130  Biosynthesis of antibiotics
wjo01200  Carbon metabolism
wjo01212  Fatty acid metabolism
Module
wjo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FOL01_0606
   00640 Propanoate metabolism
    FOL01_0606
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FOL01_0606
Enzymes [BR:wjo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     FOL01_0606
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     FOL01_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: APS41465
UniProt: A0A1L6RAB2
LinkDB All DBs
Position
660496..661872
Genome map
AA seq 458 aa AA seqDB search
MFKKVLVANRGEIAVRIIRTLKEMGIKSVAIYSSADADSLHVRLADEAIAVGGPRSKDSY
LNMKNILSAAVLTGAEAIHPGYGFLSENEAFAEMVGAVGLKWIGPSPKVLELMGNKANAR
ESMREAGVPVIPGSEGFIHNASEAKKVAERIGYPLLLKAAAGGGGKGMRFVYAENELADK
FDDAQHEAKAAFGDGHMYVEKVMTNVRHIEMQIIRDQQGNVLYFPERNCSLQRNNQKVME
ESPAVGVTQAMRDELGAIATKAVNALDYENTGTLEFLEDHEGNFYFMEMNTRIQVEHPVT
ELVTGVDLIKMQVQVAAGEVLTMHQSDIKVNGHAIEVRLNAEQPERNFAPSAGKINFVFL
PTGGPGIRIDSAIYSGDIIQPFYDSMIGKLLVHGDDRDEAVIKMKRILDEMVVDGVNTNA
DFQEALLNDGVVAKGLFTTQYLEQEFLPKWQKSLTTGE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaagttttagtggcgaatcgaggagaaattgcggttcgtatcattcgtaca
ctgaaggaaatgggcattaaatctgtcgctatttattcttcagccgatgcggatagtctt
catgtgcgattagcagatgaagcaattgccgttggtggaccaaggtcaaaagacagttac
ttaaatatgaagaatattttaagtgctgctgtattgactggtgctgaggctatccatcca
ggctatggtttcttatctgaaaatgaagcctttgctgaaatggtgggggccgttggtctt
aagtggattggaccaagtcctaaggtattggaattgatgggaaacaaagcaaacgcgcgt
gagtcaatgcgtgaagctggtgtaccagtcattccgggatctgaaggctttattcataat
gccagtgaagcgaaaaaggtggctgaacgaattggttatcctttgttactaaaagctgct
gccggtggtggtggtaaaggtatgcgttttgtttatgcagaaaacgaattagccgataaa
tttgatgatgcgcaacatgaagcgaaagccgcttttggtgatgggcatatgtatgttgag
aaggtcatgacaaatgtgcgtcatattgagatgcagattattcgagaccaacaaggtaat
gtgctatatttcccagaacgtaattgctcattacagcgtaataatcaaaaagtgatggaa
gaaagtccagcagttggtgtgacacaagcaatgcgtgatgaattgggagctatcgcgacc
aaggctgtcaatgcattggattatgaaaacaccggaacactggagtttttggaagatcat
gagggcaatttctacttcatggaaatgaacacgcgcattcaggttgaacacccagttact
gagttggttactggtgttgatttgataaagatgcaggtacaagtcgctgcaggtgaagtg
ttaacaatgcatcaatcagacattaaagtgaatgggcatgcgattgaagtacgattaaat
gctgaacaaccagagcgtaactttgcgccaagtgctggaaagattaattttgtctttctg
ccaactggtggacctggtatacgtattgattctgcgatttactcaggtgacattattcaa
ccattctacgattcaatgattggaaagttactggtacatggtgatgaccgtgatgaagca
gtaattaagatgaaacgtattttggatgaaatggtcgttgatggtgttaatacgaatgct
gatttccaagaagcattgttaaatgacggtgttgtcgccaaaggattgtttacaacgcag
taccttgagcaggaatttttaccaaaatggcaaaaaagtttaacaacaggtgaatag

DBGET integrated database retrieval system