KEGG   Weissella jogaejeotgali: FOL01_1151Help
Entry
FOL01_1151        CDS       T04632                                 

Definition
(GenBank) Amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
wjo  Weissella jogaejeotgali
Brite
KEGG Orthology (KO) [BR:wjo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FOL01_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: APS42010
UniProt: A0A1L6RC05
LinkDB All DBs
Position
complement(1215790..1217202)
Genome map
AA seq 470 aa AA seqDB search
MSSLFRKKDINRLTENASPLKRTLHTWDLTFLGIGAIIGTGIFVLTGKGALTAGPALSVS
FLIAAICCGFAGLCYAEFASMAPVAGSAYTYSYIAFGEIIAFIMGWDLILEYALGAATVS
VGWSGYFVNLLDNMGIHIPTALTAAAGTTPGVQTFFNLPAFVIVLIITWIISVGITQTKR
VNDTMVIIKLAVIVLFVVCTVWFIKPENWQPFSPFGLYSHTDGVATGIIPAASIVFFSFI
GFDSVSSSAEETVNPSKTLPRGILYSLLISTVLYIIMTLIMTGVVKYTVFSKYLNAPILA
ILAKTGQTWLSIIVSLGAILGMTTVILVQLYGQSRISYSMARDGLFPEFFGHVDEKHQTP
FKGTWFFGIITALAGGFINLNILSELVNIGTLTAFILVSAGIMIMRRTKPNLHRGFKAPW
VPVTPVIAIVFCVVLIAGLNWETWLRFLVWLALGMVLYFGYGKRHADTKF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattatttcgaaagaaagatattaatagactaacggaaaatgcttcgccgtta
aaaagaaccttacatacttgggatctgacctttttagggattggagccatcattggtaca
ggaatctttgttttaactggtaaaggagctttgaccgctggtccagctttgtctgtatcg
tttttaattgctgctatctgttgtggttttgctggtttatgttacgctgaatttgcctca
atggcgcccgtagctggttctgcctatacttattcatatattgcatttggtgaaattatt
gcgtttattatggggtgggatttgatacttgagtacgccctcggagctgcaacggtttca
gttggatggtctgggtactttgttaatctattagataatatgggtatccatataccaacg
gctctaactgctgctgccggaacgacgccgggtgttcagaccttttttaatctgccagcg
tttgttattgttttaatcattacatggattatttcggtggggattacgcaaaccaagcga
gttaatgatacgatggtcatcattaagttagcagtgattgttttattcgttgtctgcacg
gtttggttcatcaaacctgaaaactggcagccgtttagtccattcggtctttattcgcat
actgacggggtggcaaccggaattattcccgcagcatcgattgttttcttctcatttatc
ggttttgattcagtttcttcaagtgctgaggaaacggttaatcctagcaagacgttacca
agaggtattctatattcactactaatttcaacagtcctttacattatcatgacattaatt
atgacgggtgttgtgaagtacactgtattttcaaaatatttgaatgctcctattttggct
attttggccaagacagggcaaacatggctatcaattattgttagcttgggagctattctc
ggtatgacaactgttattttggttcagctttatgggcaatcacgtatcagttattcaatg
gcgcgagatggtcttttcccagaattctttggtcacgttgatgaaaaacaccaaacaccg
tttaaaggaacgtggttctttggtattatcactgctttagctggtggattcattaactta
aatattttgtcagaattggtcaacattggaacattaacagcatttatcttagtatctgca
ggtattatgattatgcgtcgtacaaagcctaacttacatcgaggttttaaggctccttgg
gtgccagtcacaccggtcattgccattgtcttttgtgttgttttgattgctggtttgaat
tgggaaacatggttgcgtttcctcgtttggttggctcttggaatggtgctatactttggt
tatggtaaacgtcatgctgacacaaagttttaa

DBGET integrated database retrieval system