KEGG   Weissella koreensis: WKK_04510
Entry
WKK_04510         CDS       T01577                                 

Definition
(GenBank) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
wko  Weissella koreensis
Pathway
wko03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:wko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    WKK_04510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:wko03400]
    WKK_04510
DNA repair and recombination proteins [BR:wko03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     WKK_04510
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      WKK_04510
SSDB
Motif
Pfam: UvrA_DNA-bind UvrA_inter ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_22 AAA_21 AAA_14 AAA_25 BCA_ABC_TP_C DnaJ_CXXCXGXG RNA12 DUF2075 Viral_helicase1 ATPase_2 MMR_HSR1 NACHT cobW RNA_helicase Septin DUF815 Dynamin_N
Other DBs
NCBI-ProteinID: AEJ23774
UniProt: F8HZ65
LinkDB
Position
947750..950605
AA seq 951 aa
MANDWITIHGARTHNLKNVDVKMPRDKFVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLGQSDKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDYYRLLYARVGKP
DQPADGTIIKPSIDQMLNYLTENLPEGSKLQILSPIVRHKRGSHATAFERIKKEGYIRVM
VDGELYDISEDIKLDKNKYHDVSIVVDRIVLRDSSRTRLFESFEAAMHMAEGVVSVAVVD
GSILQFSDHYTGALKDFGVGKLSPALFSFNAPMGACEVCGGLGVKVEVDLELVVPDQTLT
LEEGAIAAWNPISSKYYPEMLRQFADQFDIPMNIAFQDLTDEQKNFILYGAGEKTFHFHY
KNDFGGVRDVDSEFEGVINNINRRYQESNSDFTREVMRGYMTALPCSTCHGYRLNAGALS
VKIGEKHIGQVSAMPIEDELAFFDNLQFSEQDAEIARPITKEIRDRLNFLKNVGLEYLTL
SRSARTLSGGEAQRIRLATQIGSNLSGVMYVLDEPSIGLHQRDNNRLIASLQKMRDLGNT
LIVVEHDEDTMLAADYLIDVGPGAGEHGGEIMAYGTPEEVRNNPRSLTGQYLRGEKFIPV
PKKRRTGNGNFLTIKGASENNLKNVDVDIPLGEFVVVTGVSGSGKSSLVNSVIKKALKRE
INRNTEKPGAYKEMTGWEQLDKIVDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNEAK
MRGYKKGRFSFNTKGGRCEACKGDGVLKIEMNFLPDVYVKCEVCGGTRFNSETLEVTYRG
LNIAQVLDLTAEQALDFFNAIPKIRRKLQTIVDVGLGYVQLGQAATTLSGGEAQRMKLAS
ELQRRSTGKTIYILDEPTTGLHVDDISRLLEVLQRLVDSGNTVLVIEHNLDVIKTADWVI
DLGPEGGEGGGKILVAGTPEKIARTKKSYTGNYLGPLMERDIEREKKQIKA
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggcaaatgattggattacaattcacggggcgcgtacacataatctgaaaaatgttgat
gtgaagatgcctcgagataagtttgtggttgtaactggtttatccggttcaggaaaaagc
tcgttggcttttgataccttgtatgcagaaggacaacgccgttacgtagaaagcttatct
gcgtatgctcgtcaatttttagggcagtctgataagccagatgttgattccattgatgga
ctaagtccagctatttctattgatcaaaagacaacttctaaaaatccgcgctcaacagtt
ggtacggttactgaaattaatgattattatcggcttttgtatgcacgagttggaaaacct
gatcaaccagctgatggaacaattattaaaccatcgattgatcaaatgttgaattattta
acagaaaacttacctgaaggtagtaagttgcaaatcttgtcaccgattgtgcggcataaa
agaggttcacatgctactgcttttgaacggattaaaaaagaaggttatatccgtgtcatg
gtggatggtgaactttatgatatttccgaagatataaaattagataaaaataaataccat
gatgtatcaattgtggttgatcgaattgttttacgtgactcttcgcgaacccgccttttt
gaatcatttgaagcagcaatgcacatggctgaaggagtagtttcagttgctgtagttgat
ggctcaatactacaattttcggatcactatacgggggcactgaaggactttggagttgga
aaactttcgcctgctttgttttcatttaatgctcccatgggagcttgtgaagtttgtgga
ggactaggggtgaaggtagaagttgaccttgaactagtagtgcccgatcaaaccctgacc
cttgaagagggagcaattgcggcttggaatccaatttcatctaagtattatccagaaatg
ttgcgtcaatttgctgatcaatttgatatcccaatgaacattgcctttcaagatttaaca
gatgaacaaaaaaactttattttgtatggagcaggagaaaagactttccacttccactat
aaaaatgattttggtggtgttcgtgatgttgactctgaatttgaaggagttattaataat
atcaatcgacgttatcaagaatctaattctgattttactcgagaagtgatgcgtggctat
atgactgctttgccatgtagtacttgtcatggttatcgtttaaatgcaggtgccctatct
gttaaaattggcgaaaagcatattggacaagtttcagcaatgccaattgaagatgaactg
gctttctttgacaatcttcaatttagcgaacaagatgcagaaattgctcggccaattacc
aaagaaattcgagatcgtttaaactttttgaaaaatgttggtctagaatatctcacgtta
tctcgttcagctcggactctttctggaggtgaagcccaacgaattcgtttggctacgcaa
attggttctaatttgtcaggggtcatgtatgttttggatgagccttcaattggtttgcat
caacgcgataataatcgattaattgcctcgctacaaaaaatgcgagatctgggaaatact
ttgattgtggttgaacatgatgaagataccatgttagccgctgattatttaattgatgta
ggaccaggagctggtgaacatggtggtgaaatcatggcttacggaacacctgaagaggtt
cgaaataatccacggtcgcttactggtcaatatctccgaggtgagaaatttattccagtg
cctaaaaagcgccgtactggaaatggtaattttttgacgattaaaggcgccagtgaaaat
aatttaaagaatgttgatgttgatattccgttgggtgaatttgttgttgtgaccggtgta
tctgggtcaggaaaatcatcattagttaattcagtgatcaaaaaagctttgaagcgcgaa
attaatcgaaacactgaaaagcctggggcatataaagaaatgactggttgggagcaattg
gataaaattgtcgatattgatcaaagtccaattggtcggactccacgttctaacccagct
acttatacaggcgtctttgatgatattcgtgatttgttcgcacaaacgaatgaagctaaa
atgcgaggttacaaaaaagggcgcttctcattcaatactaagggaggacgctgtgaagct
tgtaaaggcgatggcgtcttgaagattgagatgaacttcttgccagatgtctatgttaaa
tgtgaagtgtgtggtggtacgcgttttaattctgaaacattagaagtaacttatcgtggc
ctaaatatcgcacaagtattagacttaacggcagaacaagccttagatttctttaatgcc
attccaaaaattcgacgtaaacttcaaacgattgtggatgtgggcttgggctacgtgcaa
ttagggcaagcagctacgaccttatctggtggtgaagcccaacgaatgaagttggcctca
gagttacaacgccgatcaacaggtaaaacaatttatattttggatgaaccaacaacggga
ctacatgtagatgatatttcacggttacttgaagttctacaacgtttagttgatagtgga
aataccgtcttagtgattgaacataatcttgatgtcattaagacagctgattgggtgatc
gatttgggtcccgaaggtggtgaaggtggcggtaaaattttggtggcaggaacgccagaa
aaaattgcccgaactaaaaaatcatacactggaaattatttaggccctttgatggaacgt
gatattgaacgagaaaaaaagcaaattaaagcttaa

DBGET integrated database retrieval system