KEGG   Weissella koreensis: WKK_06115Help
Entry
WKK_06115         CDS       T01577                                 

Definition
(GenBank) hypothetical protein
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
wko  Weissella koreensis
Brite
KEGG Orthology (KO) [BR:wko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WKK_06115
Enzymes [BR:wko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     WKK_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP MTS Methyltransf_25 PrmA Methyltransf_31 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: AEJ24093
UniProt: F8HYJ9
LinkDB All DBs
Position
1284443..1285579
Genome map
AA seq 378 aa AA seqDB search
MTEPTFKLMAVMGAGMEAIVAKELKNLGYQVRTENGRVFFEGTLTDIYRANLWLRVADRI
KIVLTEFEAKTFEDLFQGVKAYPFEEILPYDAEFPVNGRSKGSILHSVPTVQSITKKAIV
ERLSETYNTRGHLPETGARYLIEAAIDKNHVMITLDTTGDSLFKRGYRTEKGGAPLKETM
AAALVDLAHWFTDNPFVDPVTGSGTIPIEAALIGRNIAPGLNREFDISDWEMFDPSIGKE
LKETARGMIDFNVELNIKGYDIDENMIDIAKDNANKAGVGEDIEFKQLAAKDWVPEDKNG
IIVANPPYGERLGDEETVRRLYGEMGDIYKNMPTWSKYILTSDEEFERAYGEKATKKRKL
YNGALKVDLYQYWGKKER
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccaacttttaaattaatggctgtcatgggcgctgggatggaagcaattgtt
gctaaagaactaaaaaatttaggttatcaagttagaactgaaaatggtcgagtgttcttt
gaaggaactttgactgatatttatcgagctaacctgtggttaagagtagcggatcgaatt
aaaattgttttgactgaatttgaagccaaaacttttgaggatttatttcaaggagttaaa
gcttatccttttgaagaaattttgccttatgacgcggaattccccgtcaatggtcggtca
aaagggtcaatcttacattccgttccaacagtccaaagtattacaaaaaaggcaattgtt
gaacgtttatctgaaacgtataatacacgaggacatttacctgaaaccggtgctcggtat
ctaattgaggcagcaattgataaaaatcatgtcatgattaccttagatactactggagac
tccctctttaaacgaggttatcgaactgaaaagggaggagcgccattgaaagaaactatg
gcagcagctcttgtagatttggctcattggtttactgataatccgtttgtcgatcccgtt
actggatctgggaccattccaattgaagctgctttaattggtcgaaatatcgcaccagga
cttaatcgcgaatttgatatttctgattgggaaatgtttgatccatcaattgggaaagaa
ttgaaagaaaccgcccgaggtatgattgattttaatgttgaattaaacatcaaaggttat
gatatcgatgaaaatatgattgatattgctaaagataatgcgaataaagctggcgttggg
gaagatattgaatttaagcaattagcagctaaagattgggtccctgaagataaaaatgga
attattgtcgctaatcctccctatggagaacgattaggtgatgaagaaaccgtccgtcgt
ttatatggcgaaatgggtgatatttataaaaatatgccaacttggtcaaaatatattttg
actagtgatgaagaatttgaaagggcatatggagaaaaagcaacgaagaaacgtaaactc
tataatggagcgttaaaggttgatttgtatcaatattggggaaaaaaggagcgttaa

DBGET integrated database retrieval system